Diaphorina citri psyllid: psy3370


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MGKGEEEEEEEEEEEEEEEEEEEDLHMCLNYLAMKKKKKKKKKKKKKKKKKKKKKNNPVVYIYALLFSISGYLGVQVVLTLVKTCGAFVAVTVTTCRKAVTIVLSFVFFAKPFTFQ
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccc
**************************MCLN************************KNNPVVYIYALLFSISGYLGVQVVLTLVKTCGAFVAVTVTTCRKAVTIVLSFVFFAKPFTF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxMCLNYxxxxxxxxxxxxxxxxxxxxxxxxxxPVVYIYALLFSISGYLGVQVVLTLVKTCGAFVAVTVTTCRKAVTIVLSFVFFAKPFTFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenosine 3'-phospho 5'-phosphosulfate transporter 2 Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi. Essential for viability. Involved in glycosaminoglycan synthesis and the subsequent signaling. May be involved in hh and dpp signaling by controlling the sulfation of heparan sulfate (HS).confidentQ7Q5D4
Adenosine 3'-phospho 5'-phosphosulfate transporter 2 Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi. Compensates for the insufficient expression of SLC35B2/PAPST1 during the synthesis of sulfated glycoconjugates in the colon.confidentQ5R831
Adenosine 3'-phospho 5'-phosphosulfate transporter 2 Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi.confidentQ20787

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046964 [MF]3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activityprobableGO:0005346, GO:0022891, GO:0015932, GO:1901682, GO:0005337, GO:0000295, GO:0008514, GO:0005215, GO:0008509, GO:0015216, GO:0015211, GO:1901677, GO:0015075, GO:0015215, GO:0022857, GO:0022892, GO:0003674, GO:1901505
GO:0046963 [BP]3'-phosphoadenosine 5'-phosphosulfate transportprobableGO:0015931, GO:0006810, GO:0015868, GO:0015748, GO:0006862, GO:0051503, GO:0015865, GO:0072348, GO:0015711, GO:0015858, GO:0044765, GO:0006820, GO:0071705, GO:0008150, GO:0071702, GO:0051179, GO:0051234, GO:0006811, GO:0044699, GO:1901264
GO:0030173 [CC]integral to Golgi membraneprobableGO:0043229, GO:0031301, GO:0031300, GO:0005622, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044431, GO:0005794, GO:0012505, GO:0043231, GO:0044464, GO:0031228, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0000137 [CC]Golgi cis cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 65-110
View the alignment between query and template
View the model in PyMOL