Diaphorina citri psyllid: psy3430


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MLASGKLPPDALPGDLAGQDCVLGLEFSGRDTKGRRVMGLVAARSLATTVLADPSFLWEVPAKWTLEEASTIPVVYATAYYSLIVRGKMRPGESLLVHAGAGGLGQAAISIALHMGCTVYT
cCCccccccccccccccCEEEEEcccCCcccccccEEEEEcccccccEEEEEccccCECccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccEEcc
*LASGKLPPDALPGDLAGQDCVLGLEFSGRDTKGRRVMGLVAARSLATTVLADPSFLWEVPAKWTLEEASTIPVVYATAYYSLIVRGKMRPGESLLVHAGAGGLGQAAISIALHMGCTVYT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLASGKLPPDALPGDLAGQDCVLGLEFSGRDTKGRRVMGLVAARSLATTVLADPSFLWEVPAKWTLEEASTIPVVYATAYYSLIVRGKMRPGESLLVHAGAGGLGQAAISIALHMGCTVYT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Fatty acid synthase Fatty acid synthetase catalyzes the formation of long-chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. This multifunctional protein has 7 catalytic activities and an acyl carrier protein.confidentP19096
Fatty acid synthase Fatty acid synthetase catalyzes the formation of long-chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. This multifunctional protein has 7 catalytic activities and an acyl carrier protein.confidentP49327
Fatty acid synthase Fatty acid synthetase catalyzes the formation of long-chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. This multifunctional protein has 7 catalytic activities and an acyl carrier protein.confidentP12276

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071766 [BP]Actinobacterium-type cell wall biogenesisprobableGO:0042546, GO:0009987, GO:0071554, GO:0009273, GO:0044085, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0070402 [MF]NADPH bindingprobableGO:0043168, GO:0050662, GO:0050661, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0043167, GO:1901363, GO:1901265
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006633 [BP]fatty acid biosynthetic processprobableGO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042587 [CC]glycogen granuleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0006084 [BP]acetyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006725 [BP]cellular aromatic compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0071353 [BP]cellular response to interleukin-4probableGO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0070670, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0003960 [MF]NADPH:quinone reductase activityprobableGO:0016655, GO:0003824, GO:0003674, GO:0016651, GO:0016491
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SLK, chain A
Confidence level:very confident
Coverage over the Query: 20-121
View the alignment between query and template
View the model in PyMOL