Psyllid ID: psy3430
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| 328705168 | 2113 | PREDICTED: fatty acid synthase-like [Acy | 1.0 | 0.057 | 0.826 | 5e-56 | |
| 328705164 | 2389 | PREDICTED: fatty acid synthase-like isof | 1.0 | 0.050 | 0.834 | 7e-56 | |
| 328705166 | 2395 | PREDICTED: fatty acid synthase-like isof | 1.0 | 0.050 | 0.834 | 7e-56 | |
| 189233593 | 3189 | PREDICTED: similar to fatty acid synthas | 1.0 | 0.037 | 0.801 | 2e-55 | |
| 270014917 | 2383 | hypothetical protein TcasGA2_TC011522 [T | 1.0 | 0.050 | 0.801 | 9e-55 | |
| 242023225 | 2381 | fatty acid synthase, putative [Pediculus | 1.0 | 0.050 | 0.785 | 3e-54 | |
| 345479260 | 2408 | PREDICTED: fatty acid synthase-like isof | 1.0 | 0.050 | 0.785 | 1e-52 | |
| 345479258 | 2398 | PREDICTED: fatty acid synthase-like isof | 1.0 | 0.050 | 0.785 | 1e-52 | |
| 374092388 | 2392 | fatty acid synthase [Bombus lucorum] | 1.0 | 0.050 | 0.727 | 2e-51 | |
| 340718780 | 2392 | PREDICTED: fatty acid synthase-like [Bom | 1.0 | 0.050 | 0.727 | 2e-51 |
| >gi|328705168|ref|XP_001945287.2| PREDICTED: fatty acid synthase-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 221 bits (562), Expect = 5e-56, Method: Composition-based stats.
Identities = 100/121 (82%), Positives = 113/121 (93%)
Query: 1 MLASGKLPPDALPGDLAGQDCVLGLEFSGRDTKGRRVMGLVAARSLATTVLADPSFLWEV 60
MLASGKLPPDALPGDLAGQDC+LGLEFSGR++KG+R+MG++AA LATTVLADP FLWEV
Sbjct: 1481 MLASGKLPPDALPGDLAGQDCILGLEFSGRNSKGKRIMGMLAATGLATTVLADPKFLWEV 1540
Query: 61 PAKWTLEEASTIPVVYATAYYSLIVRGKMRPGESLLVHAGAGGLGQAAISIALHMGCTVY 120
P+KWTLEEASTIPVVY TAYY+L VRG+M+PG SLLVHAG GG+GQAAI+IALHMG TVY
Sbjct: 1541 PSKWTLEEASTIPVVYGTAYYALCVRGQMKPGNSLLVHAGTGGVGQAAIAIALHMGVTVY 1600
Query: 121 T 121
T
Sbjct: 1601 T 1601
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328705164|ref|XP_003242717.1| PREDICTED: fatty acid synthase-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328705166|ref|XP_001945190.2| PREDICTED: fatty acid synthase-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|189233593|ref|XP_970417.2| PREDICTED: similar to fatty acid synthase [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270014917|gb|EFA11365.1| hypothetical protein TcasGA2_TC011522 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242023225|ref|XP_002432036.1| fatty acid synthase, putative [Pediculus humanus corporis] gi|212517394|gb|EEB19298.1| fatty acid synthase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|345479260|ref|XP_001605059.2| PREDICTED: fatty acid synthase-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345479258|ref|XP_003423914.1| PREDICTED: fatty acid synthase-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|374092388|gb|AEY83835.1| fatty acid synthase [Bombus lucorum] | Back alignment and taxonomy information |
|---|
| >gi|340718780|ref|XP_003397841.1| PREDICTED: fatty acid synthase-like [Bombus terrestris] gi|363980846|gb|AEW43642.1| fatty acid synthase [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| ZFIN|ZDB-GENE-030131-7802 | 2514 | fasn "fatty acid synthase" [Da | 1.0 | 0.048 | 0.694 | 1.7e-42 | |
| UNIPROTKB|P49327 | 2511 | FASN "Fatty acid synthase" [Ho | 1.0 | 0.048 | 0.661 | 3.3e-41 | |
| UNIPROTKB|F1Q2F6 | 2518 | FASN "Uncharacterized protein" | 1.0 | 0.048 | 0.661 | 5.3e-41 | |
| RGD|620665 | 2505 | Fasn "fatty acid synthase" [Ra | 1.0 | 0.048 | 0.669 | 8.6e-41 | |
| UNIPROTKB|P12785 | 2505 | Fasn "Fatty acid synthase" [Ra | 1.0 | 0.048 | 0.669 | 8.6e-41 | |
| FB|FBgn0042627 | 2409 | v(2)k05816 "v(2)k05816" [Droso | 1.0 | 0.050 | 0.694 | 1.7e-40 | |
| FB|FBgn0027571 | 2544 | CG3523 [Drosophila melanogaste | 1.0 | 0.047 | 0.669 | 2.3e-40 | |
| MGI|MGI:95485 | 2504 | Fasn "fatty acid synthase" [Mu | 1.0 | 0.048 | 0.661 | 6.1e-40 | |
| UNIPROTKB|F1N8A8 | 2512 | FASN "Fatty acid synthase" [Ga | 0.991 | 0.047 | 0.666 | 4.4e-39 | |
| UNIPROTKB|P12276 | 2512 | FASN "Fatty acid synthase" [Ga | 0.991 | 0.047 | 0.666 | 4.4e-39 |
| ZFIN|ZDB-GENE-030131-7802 fasn "fatty acid synthase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 466 (169.1 bits), Expect = 1.7e-42, P = 1.7e-42
Identities = 84/121 (69%), Positives = 107/121 (88%)
Query: 1 MLASGKLPPDALPGDLAGQDCVLGLEFSGRDTKGRRVMGLVAARSLATTVLADPSFLWEV 60
MLA+GKLPPDA+PGD+A Q C+LG+EFSGRD GRRVMGL+ A+ LAT V AD FLW+V
Sbjct: 1586 MLATGKLPPDAIPGDVALQQCMLGMEFSGRDPSGRRVMGLLPAKGLATCVDADKRFLWDV 1645
Query: 61 PAKWTLEEASTIPVVYATAYYSLIVRGKMRPGESLLVHAGAGGLGQAAISIALHMGCTVY 120
P+ WTLE+A+++PVVYATAYYSL+VRG++RPGES+L+H+G+GG+GQAAI+IAL M C V+
Sbjct: 1646 PSSWTLEQAASVPVVYATAYYSLVVRGRLRPGESVLIHSGSGGVGQAAIAIALSMRCRVF 1705
Query: 121 T 121
T
Sbjct: 1706 T 1706
|
|
| UNIPROTKB|P49327 FASN "Fatty acid synthase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q2F6 FASN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|620665 Fasn "fatty acid synthase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P12785 Fasn "Fatty acid synthase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0042627 v(2)k05816 "v(2)k05816" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0027571 CG3523 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95485 Fasn "fatty acid synthase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N8A8 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P12276 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 121 | |||
| smart00829 | 287 | smart00829, PKS_ER, Enoylreductase | 2e-45 | |
| cd05195 | 293 | cd05195, enoyl_red, enoyl reductase of polyketide | 9e-42 | |
| cd08241 | 323 | cd08241, QOR1, Quinone oxidoreductase (QOR) | 6e-27 | |
| cd05276 | 323 | cd05276, p53_inducible_oxidoreductase, PIG3 p53-in | 2e-25 | |
| cd08275 | 337 | cd08275, MDR3, Medium chain dehydrogenases/reducta | 1e-23 | |
| TIGR02824 | 325 | TIGR02824, quinone_pig3, putative NAD(P)H quinone | 8e-20 | |
| cd08267 | 319 | cd08267, MDR1, Medium chain dehydrogenases/reducta | 1e-18 | |
| PTZ00354 | 334 | PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi | 8e-18 | |
| cd08272 | 326 | cd08272, MDR6, Medium chain dehydrogenases/reducta | 1e-17 | |
| cd08266 | 342 | cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t | 3e-17 | |
| COG0604 | 326 | COG0604, Qor, NADPH:quinone reductase and related | 5e-17 | |
| cd05188 | 271 | cd05188, MDR, Medium chain reductase/dehydrogenase | 2e-16 | |
| cd05289 | 309 | cd05289, MDR_like_2, alcohol dehydrogenase and qui | 2e-14 | |
| cd08251 | 303 | cd08251, polyketide_synthase, polyketide synthase | 3e-12 | |
| cd08253 | 325 | cd08253, zeta_crystallin, Zeta-crystallin with NAD | 7e-12 | |
| cd08249 | 339 | cd08249, enoyl_reductase_like, enoyl_reductase_lik | 2e-11 | |
| cd08273 | 331 | cd08273, MDR8, Medium chain dehydrogenases/reducta | 4e-10 | |
| cd08254 | 338 | cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e | 9e-09 | |
| COG1064 | 339 | COG1064, AdhP, Zn-dependent alcohol dehydrogenases | 1e-08 | |
| cd08268 | 328 | cd08268, MDR2, Medium chain dehydrogenases/reducta | 2e-08 | |
| cd08271 | 325 | cd08271, MDR5, Medium chain dehydrogenases/reducta | 4e-08 | |
| cd08250 | 329 | cd08250, Mgc45594_like, Mgc45594 gene product and | 4e-08 | |
| cd08276 | 336 | cd08276, MDR7, Medium chain dehydrogenases/reducta | 8e-08 | |
| cd05288 | 329 | cd05288, PGDH, Prostaglandin dehydrogenases | 1e-07 | |
| cd08246 | 393 | cd08246, crotonyl_coA_red, crotonyl-CoA reductase | 2e-07 | |
| COG2130 | 340 | COG2130, COG2130, Putative NADP-dependent oxidored | 3e-07 | |
| cd08243 | 320 | cd08243, quinone_oxidoreductase_like_1, Quinone ox | 3e-07 | |
| TIGR01751 | 398 | TIGR01751, crot-CoA-red, crotonyl-CoA reductase | 6e-07 | |
| cd08270 | 305 | cd08270, MDR4, Medium chain dehydrogenases/reducta | 1e-06 | |
| cd08274 | 350 | cd08274, MDR9, Medium chain dehydrogenases/reducta | 1e-06 | |
| cd08264 | 325 | cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t | 2e-06 | |
| cd05286 | 320 | cd05286, QOR2, Quinone oxidoreductase (QOR) | 2e-06 | |
| cd08260 | 345 | cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD | 6e-06 | |
| cd08248 | 350 | cd08248, RTN4I1, Human Reticulon 4 Interacting Pro | 7e-06 | |
| cd05282 | 323 | cd05282, ETR_like, 2-enoyl thioester reductase-lik | 3e-05 | |
| cd08290 | 341 | cd08290, ETR, 2-enoyl thioester reductase (ETR) | 3e-05 | |
| cd08252 | 336 | cd08252, AL_MDR, Arginate lyase and other MDR fami | 4e-05 | |
| cd08259 | 332 | cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD | 4e-05 | |
| cd08258 | 306 | cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD | 1e-04 | |
| cd08263 | 367 | cd08263, Zn_ADH10, Alcohol dehydrogenases of the M | 2e-04 | |
| PRK13771 | 334 | PRK13771, PRK13771, putative alcohol dehydrogenase | 5e-04 | |
| cd08247 | 352 | cd08247, AST1_like, AST1 is a cytoplasmic protein | 6e-04 | |
| cd08244 | 324 | cd08244, MDR_enoyl_red, Possible enoyl reductase | 7e-04 | |
| cd08294 | 329 | cd08294, leukotriene_B4_DH_like, 13-PGR is a bifun | 0.001 | |
| cd08255 | 277 | cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro | 0.001 |
| >gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase | Back alignment and domain information |
|---|
Score = 147 bits (375), Expect = 2e-45
Identities = 53/122 (43%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
Query: 1 MLASGKLP-PDALPGDLAGQDCVLGLEFSGRDTKGRRVMGLVAARSLATTVLADPSFLWE 59
++A G P L G+ AG +G +G G RVMGL + AT V+ D +
Sbjct: 14 LIALGLYPGEAVLGGECAGVVTRVGPGVTGLA-VGDRVMGLAPG-AFATRVVTDARLVVP 71
Query: 60 VPAKWTLEEASTIPVVYATAYYSLIVRGKMRPGESLLVHAGAGGLGQAAISIALHMGCTV 119
+P W+ EEA+T+PVV+ TAYY+L+ ++RPGES+L+HA AGG+GQAAI +A H+G V
Sbjct: 72 IPDGWSFEEAATVPVVFLTAYYALVDLARLRPGESVLIHAAAGGVGQAAIQLARHLGAEV 131
Query: 120 YT 121
+
Sbjct: 132 FA 133
|
Enoylreductase in Polyketide synthases. Length = 287 |
| >gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family | Back alignment and domain information |
|---|
| >gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases | Back alignment and domain information |
|---|
| >gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like | Back alignment and domain information |
|---|
| >gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast | Back alignment and domain information |
|---|
| >gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176254 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 99.95 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 99.94 | |
| KOG1197|consensus | 336 | 99.92 | ||
| KOG0025|consensus | 354 | 99.89 | ||
| TIGR02818 | 368 | adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr | 99.87 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 99.86 | |
| TIGR02822 | 329 | adh_fam_2 zinc-binding alcohol dehydrogenase famil | 99.86 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 99.86 | |
| KOG0023|consensus | 360 | 99.86 | ||
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 99.86 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 99.85 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 99.85 | |
| cd08301 | 369 | alcohol_DH_plants Plant alcohol dehydrogenase. NAD | 99.85 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 99.85 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 99.85 | |
| cd08237 | 341 | ribitol-5-phosphate_DH ribitol-5-phosphate dehydro | 99.85 | |
| KOG0024|consensus | 354 | 99.84 | ||
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 99.84 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 99.84 | |
| cd08300 | 368 | alcohol_DH_class_III class III alcohol dehydrogena | 99.84 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 99.84 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 99.84 | |
| KOG1198|consensus | 347 | 99.84 | ||
| TIGR02817 | 336 | adh_fam_1 zinc-binding alcohol dehydrogenase famil | 99.84 | |
| cd08277 | 365 | liver_alcohol_DH_like Liver alcohol dehydrogenase. | 99.84 | |
| PLN02827 | 378 | Alcohol dehydrogenase-like | 99.84 | |
| PLN02178 | 375 | cinnamyl-alcohol dehydrogenase | 99.83 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 99.83 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 99.83 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 99.82 | |
| cd08274 | 350 | MDR9 Medium chain dehydrogenases/reductase (MDR)/z | 99.82 | |
| cd08290 | 341 | ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi | 99.82 | |
| cd08243 | 320 | quinone_oxidoreductase_like_1 Quinone oxidoreducta | 99.82 | |
| PTZ00354 | 334 | alcohol dehydrogenase; Provisional | 99.81 | |
| cd08270 | 305 | MDR4 Medium chain dehydrogenases/reductase (MDR)/z | 99.81 | |
| KOG1202|consensus | 2376 | 99.81 | ||
| cd08289 | 326 | MDR_yhfp_like Yhfp putative quinone oxidoreductase | 99.8 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 99.8 | |
| cd08299 | 373 | alcohol_DH_class_I_II_IV class I, II, IV alcohol d | 99.8 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 99.8 | |
| cd08246 | 393 | crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- | 99.8 | |
| COG1062 | 366 | AdhC Zn-dependent alcohol dehydrogenases, class II | 99.8 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 99.8 | |
| cd05280 | 325 | MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone | 99.79 | |
| cd08296 | 333 | CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci | 99.79 | |
| cd08244 | 324 | MDR_enoyl_red Possible enoyl reductase. Member ide | 99.79 | |
| cd08291 | 324 | ETR_like_1 2-enoyl thioester reductase (ETR) like | 99.79 | |
| cd05282 | 323 | ETR_like 2-enoyl thioester reductase-like. 2-enoyl | 99.79 | |
| cd08231 | 361 | MDR_TM0436_like Hypothetical enzyme TM0436 resembl | 99.79 | |
| cd05284 | 340 | arabinose_DH_like D-arabinose dehydrogenase. This | 99.79 | |
| cd08248 | 350 | RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu | 99.79 | |
| cd08273 | 331 | MDR8 Medium chain dehydrogenases/reductase (MDR)/z | 99.79 | |
| TIGR02823 | 323 | oxido_YhdH putative quinone oxidoreductase, YhdH/Y | 99.78 | |
| TIGR02819 | 393 | fdhA_non_GSH formaldehyde dehydrogenase, glutathio | 99.78 | |
| KOG0022|consensus | 375 | 99.78 | ||
| cd08264 | 325 | Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam | 99.78 | |
| cd05279 | 365 | Zn_ADH1 Liver alcohol dehydrogenase and related zi | 99.78 | |
| cd08251 | 303 | polyketide_synthase polyketide synthase. Polyketid | 99.78 | |
| cd08259 | 332 | Zn_ADH5 Alcohol dehydrogenases of the MDR family. | 99.78 | |
| cd08233 | 351 | butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog | 99.78 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 99.78 | |
| cd05195 | 293 | enoyl_red enoyl reductase of polyketide synthase. | 99.77 | |
| smart00829 | 288 | PKS_ER Enoylreductase. Enoylreductase in Polyketid | 99.77 | |
| cd05276 | 323 | p53_inducible_oxidoreductase PIG3 p53-inducible qu | 99.77 | |
| PRK10754 | 327 | quinone oxidoreductase, NADPH-dependent; Provision | 99.77 | |
| cd08278 | 365 | benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be | 99.77 | |
| cd08249 | 339 | enoyl_reductase_like enoyl_reductase_like. Member | 99.77 | |
| cd08255 | 277 | 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ | 99.76 | |
| cd08260 | 345 | Zn_ADH6 Alcohol dehydrogenases of the MDR family. | 99.76 | |
| PRK13771 | 334 | putative alcohol dehydrogenase; Provisional | 99.76 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 99.76 | |
| cd08253 | 325 | zeta_crystallin Zeta-crystallin with NADP-dependen | 99.76 | |
| cd08250 | 329 | Mgc45594_like Mgc45594 gene product and other MDR | 99.76 | |
| TIGR01751 | 398 | crot-CoA-red crotonyl-CoA reductase. The enzyme mo | 99.76 | |
| cd08252 | 336 | AL_MDR Arginate lyase and other MDR family members | 99.76 | |
| PRK09422 | 338 | ethanol-active dehydrogenase/acetaldehyde-active r | 99.76 | |
| cd08288 | 324 | MDR_yhdh Yhdh putative quinone oxidoreductases. Yh | 99.76 | |
| TIGR02824 | 325 | quinone_pig3 putative NAD(P)H quinone oxidoreducta | 99.76 | |
| cd08285 | 351 | NADP_ADH NADP(H)-dependent alcohol dehydrogenases. | 99.76 | |
| PRK10083 | 339 | putative oxidoreductase; Provisional | 99.76 | |
| cd08267 | 319 | MDR1 Medium chain dehydrogenases/reductase (MDR)/z | 99.75 | |
| cd08261 | 337 | Zn_ADH7 Alcohol dehydrogenases of the MDR family. | 99.75 | |
| cd05278 | 347 | FDH_like Formaldehyde dehydrogenases. Formaldehyde | 99.75 | |
| cd08254 | 338 | hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo | 99.75 | |
| cd08283 | 386 | FDH_like_1 Glutathione-dependent formaldehyde dehy | 99.75 | |
| cd08297 | 341 | CAD3 Cinnamyl alcohol dehydrogenases (CAD). These | 99.75 | |
| cd08262 | 341 | Zn_ADH8 Alcohol dehydrogenases of the MDR family. | 99.75 | |
| cd08298 | 329 | CAD2 Cinnamyl alcohol dehydrogenases (CAD). These | 99.75 | |
| cd05286 | 320 | QOR2 Quinone oxidoreductase (QOR). Quinone oxidore | 99.75 | |
| cd08236 | 343 | sugar_DH NAD(P)-dependent sugar dehydrogenases. Th | 99.75 | |
| cd08247 | 352 | AST1_like AST1 is a cytoplasmic protein associated | 99.75 | |
| cd08284 | 344 | FDH_like_2 Glutathione-dependent formaldehyde dehy | 99.74 | |
| cd08238 | 410 | sorbose_phosphate_red L-sorbose-1-phosphate reduct | 99.74 | |
| cd08279 | 363 | Zn_ADH_class_III Class III alcohol dehydrogenase. | 99.74 | |
| cd08235 | 343 | iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ | 99.74 | |
| cd08258 | 306 | Zn_ADH4 Alcohol dehydrogenases of the MDR family. | 99.74 | |
| cd08263 | 367 | Zn_ADH10 Alcohol dehydrogenases of the MDR family. | 99.74 | |
| cd08286 | 345 | FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik | 99.73 | |
| cd08272 | 326 | MDR6 Medium chain dehydrogenases/reductase (MDR)/z | 99.73 | |
| cd08240 | 350 | 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy | 99.73 | |
| cd05283 | 337 | CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam | 99.73 | |
| cd08268 | 328 | MDR2 Medium chain dehydrogenases/reductase (MDR)/z | 99.73 | |
| cd08265 | 384 | Zn_ADH3 Alcohol dehydrogenases of the MDR family. | 99.73 | |
| cd08245 | 330 | CAD Cinnamyl alcohol dehydrogenases (CAD) and rela | 99.72 | |
| cd08266 | 342 | Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam | 99.72 | |
| cd05285 | 343 | sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a | 99.72 | |
| cd08282 | 375 | PFDH_like Pseudomonas putida aldehyde-dismutating | 99.72 | |
| cd05288 | 329 | PGDH Prostaglandin dehydrogenases. Prostaglandins | 99.72 | |
| cd08271 | 325 | MDR5 Medium chain dehydrogenases/reductase (MDR)/z | 99.72 | |
| cd08232 | 339 | idonate-5-DH L-idonate 5-dehydrogenase. L-idonate | 99.72 | |
| cd08275 | 337 | MDR3 Medium chain dehydrogenases/reductase (MDR)/z | 99.71 | |
| cd08276 | 336 | MDR7 Medium chain dehydrogenases/reductase (MDR)/z | 99.7 | |
| cd05289 | 309 | MDR_like_2 alcohol dehydrogenase and quinone reduc | 99.7 | |
| cd08242 | 319 | MDR_like Medium chain dehydrogenases/reductase (MD | 99.7 | |
| cd08234 | 334 | threonine_DH_like L-threonine dehydrogenase. L-thr | 99.7 | |
| cd08256 | 350 | Zn_ADH2 Alcohol dehydrogenases of the MDR family. | 99.69 | |
| cd08241 | 323 | QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t | 99.69 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 99.68 | |
| cd08269 | 312 | Zn_ADH9 Alcohol dehydrogenases of the MDR family. | 99.68 | |
| COG2130 | 340 | Putative NADP-dependent oxidoreductases [General f | 99.66 | |
| TIGR00692 | 340 | tdh L-threonine 3-dehydrogenase. E. coli His-90 mo | 99.66 | |
| PLN02702 | 364 | L-idonate 5-dehydrogenase | 99.65 | |
| cd08287 | 345 | FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik | 99.64 | |
| cd05281 | 341 | TDH Threonine dehydrogenase. L-threonine dehydroge | 99.62 | |
| PRK05396 | 341 | tdh L-threonine 3-dehydrogenase; Validated | 99.61 | |
| KOG1196|consensus | 343 | 99.54 | ||
| PF08240 | 109 | ADH_N: Alcohol dehydrogenase GroES-like domain; In | 98.64 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 96.86 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 96.75 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 96.71 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 96.46 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 96.14 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.03 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 95.77 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 95.49 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 95.48 | |
| PLN02494 | 477 | adenosylhomocysteinase | 95.46 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 95.41 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 95.32 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 95.29 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 95.18 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 95.17 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 95.16 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 95.14 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 94.95 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 94.93 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 94.91 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 94.89 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 94.86 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 94.85 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 94.82 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 94.81 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 94.81 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 94.79 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 94.75 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 94.67 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 94.63 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 94.42 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 94.4 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.33 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 94.04 | |
| KOG1201|consensus | 300 | 94.04 | ||
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 94.01 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.99 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 93.97 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 93.79 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 93.78 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 93.71 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 93.62 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 93.6 | |
| PF10686 | 71 | DUF2493: Protein of unknown function (DUF2493); In | 93.59 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 93.45 | |
| KOG1205|consensus | 282 | 93.4 | ||
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase | 93.13 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 93.12 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 93.11 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 92.67 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 92.57 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 92.56 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 92.42 | |
| PF12242 | 78 | Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 | 92.38 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 92.16 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.06 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 91.99 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 91.87 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 91.82 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 91.68 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 91.62 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 91.5 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 91.22 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 91.08 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 91.0 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 90.94 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 90.9 | |
| PLN02928 | 347 | oxidoreductase family protein | 90.83 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 90.62 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 90.41 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 90.38 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 90.31 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 90.25 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 90.24 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 90.24 | |
| PLN02477 | 410 | glutamate dehydrogenase | 90.05 | |
| KOG1200|consensus | 256 | 89.89 | ||
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 89.87 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 89.84 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 89.78 | |
| KOG1208|consensus | 314 | 89.68 | ||
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 89.63 | |
| PF13580 | 138 | SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_ | 89.54 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 89.5 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 89.25 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 89.14 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 89.08 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 88.89 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 88.88 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 88.78 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 88.71 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 88.71 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 88.31 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 88.18 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 87.94 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 87.87 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 87.65 | |
| KOG1252|consensus | 362 | 87.5 | ||
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 87.48 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 87.47 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 87.25 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 86.95 | |
| PF00208 | 244 | ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val | 86.78 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 86.68 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 86.5 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 86.23 | |
| KOG1210|consensus | 331 | 85.59 | ||
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 85.54 | |
| KOG2862|consensus | 385 | 85.52 | ||
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 85.5 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 85.27 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 85.18 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 85.02 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.95 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 84.68 | |
| cd01079 | 197 | NAD_bind_m-THF_DH NAD binding domain of methylene- | 84.65 | |
| TIGR00521 | 390 | coaBC_dfp phosphopantothenoylcysteine decarboxylas | 84.6 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 84.49 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 84.44 | |
| PRK14180 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.3 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 84.18 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 84.08 | |
| PRK14172 | 278 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.98 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.88 | |
| PRK14190 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.81 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 83.5 | |
| KOG1610|consensus | 322 | 83.44 | ||
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 83.26 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 83.22 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 83.1 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.08 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 83.05 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 82.77 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 82.53 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 82.43 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 82.27 | |
| COG0503 | 179 | Apt Adenine/guanine phosphoribosyltransferases and | 82.24 | |
| PRK14169 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 82.21 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 82.14 | |
| KOG1203|consensus | 411 | 82.13 | ||
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 82.09 | |
| PRK14173 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 81.81 | |
| PRK14166 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 81.68 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 81.55 | |
| PRK14187 | 294 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 80.95 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 80.71 | |
| PLN02516 | 299 | methylenetetrahydrofolate dehydrogenase (NADP+) | 80.51 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 80.43 | |
| PRK14170 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 80.4 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 80.39 | |
| PRK14186 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 80.12 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 80.07 |
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
Probab=99.95 E-value=5.4e-28 Score=177.55 Aligned_cols=116 Identities=34% Similarity=0.502 Sum_probs=103.6
Q ss_pred CCCCCCCCCCCCC-----CCCCCccCcceEEEE----------ccCCEEEEEc---cCCceeEEEEeCCCCeEEcCCCCC
Q psy3430 4 SGKLPPDALPGDL-----AGQDCVLGLEFSGRD----------TKGRRVMGLV---AARSLATTVLADPSFLWEVPAKWT 65 (121)
Q Consensus 4 ~g~~~~~~~~~~~-----~~~~~~~G~e~~G~V----------~~Gd~V~~~~---~~g~~~~~~~v~~~~~~~~p~~~~ 65 (121)
.|.+|.|.+.... .++|.++|.|++|+| ++||+|+... .+|+|+||.++|++.++++|+++|
T Consensus 37 ~gvN~~D~~~r~G~~~~~~~~P~i~G~d~aG~V~avG~~V~~~~~GdrV~~~~~~~~~G~~AEy~~v~a~~~~~~P~~ls 116 (326)
T COG0604 37 AGVNPIDVLVRQGLAPPVRPLPFIPGSEAAGVVVAVGSGVTGFKVGDRVAALGGVGRDGGYAEYVVVPADWLVPLPDGLS 116 (326)
T ss_pred eecChHHHHhccCCCCCCCCCCCcccceeEEEEEEeCCCCCCcCCCCEEEEccCCCCCCcceeEEEecHHHceeCCCCCC
Confidence 3555655554432 237999999999999 6999999986 679999999999999999999999
Q ss_pred HHHHhhcchHHHHHHHHHHhhcCCCCCCEEEEecCCchHHHHHHHHHHHCCCEE
Q psy3430 66 LEEASTIPVVYATAYYSLIVRGKMRPGESLLVHAGAGGLGQAAISIALHMGCTV 119 (121)
Q Consensus 66 ~~~aa~l~~~~~ta~~~l~~~~~~~~g~~vli~ga~g~vG~~aiqla~~~G~~v 119 (121)
+++||+++++++|||+++.+..++++|++|||+||+|++|++++|+||++|+++
T Consensus 117 ~~eAAal~~~~~TA~~~l~~~~~l~~g~~VLV~gaaGgVG~~aiQlAk~~G~~~ 170 (326)
T COG0604 117 FEEAAALPLAGLTAWLALFDRAGLKPGETVLVHGAAGGVGSAAIQLAKALGATV 170 (326)
T ss_pred HHHHHHHHHHHHHHHHHHHHhcCCCCCCEEEEecCCchHHHHHHHHHHHcCCcE
Confidence 999999999999999999999999999999999999999999999999999644
|
|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1197|consensus | Back alignment and domain information |
|---|
| >KOG0025|consensus | Back alignment and domain information |
|---|
| >TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >KOG0023|consensus | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08301 alcohol_DH_plants Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >KOG0024|consensus | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >cd08300 alcohol_DH_class_III class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >KOG1198|consensus | Back alignment and domain information |
|---|
| >TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02827 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >PLN02178 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08290 ETR 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >PTZ00354 alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >KOG1202|consensus | Back alignment and domain information |
|---|
| >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >cd08246 crotonyl_coA_red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08244 MDR_enoyl_red Possible enoyl reductase | Back alignment and domain information |
|---|
| >cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 | Back alignment and domain information |
|---|
| >cd05282 ETR_like 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >cd05284 arabinose_DH_like D-arabinose dehydrogenase | Back alignment and domain information |
|---|
| >cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 | Back alignment and domain information |
|---|
| >cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family | Back alignment and domain information |
|---|
| >TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent | Back alignment and domain information |
|---|
| >KOG0022|consensus | Back alignment and domain information |
|---|
| >cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08251 polyketide_synthase polyketide synthase | Back alignment and domain information |
|---|
| >cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05195 enoyl_red enoyl reductase of polyketide synthase | Back alignment and domain information |
|---|
| >smart00829 PKS_ER Enoylreductase | Back alignment and domain information |
|---|
| >cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional | Back alignment and domain information |
|---|
| >cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08249 enoyl_reductase_like enoyl_reductase_like | Back alignment and domain information |
|---|
| >cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members | Back alignment and domain information |
|---|
| >cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK13771 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >TIGR01751 crot-CoA-red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >cd08252 AL_MDR Arginate lyase and other MDR family members | Back alignment and domain information |
|---|
| >PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional | Back alignment and domain information |
|---|
| >cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family | Back alignment and domain information |
|---|
| >cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PRK10083 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05278 FDH_like Formaldehyde dehydrogenases | Back alignment and domain information |
|---|
| >cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 | Back alignment and domain information |
|---|
| >cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd05286 QOR2 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases | Back alignment and domain information |
|---|
| >cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast | Back alignment and domain information |
|---|
| >cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase | Back alignment and domain information |
|---|
| >cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase | Back alignment and domain information |
|---|
| >cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase | Back alignment and domain information |
|---|
| >cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins | Back alignment and domain information |
|---|
| >cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05285 sorbitol_DH Sorbitol dehydrogenase | Back alignment and domain information |
|---|
| >cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) | Back alignment and domain information |
|---|
| >cd05288 PGDH Prostaglandin dehydrogenases | Back alignment and domain information |
|---|
| >cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08232 idonate-5-DH L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases | Back alignment and domain information |
|---|
| >cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08234 threonine_DH_like L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08241 QOR1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00692 tdh L-threonine 3-dehydrogenase | Back alignment and domain information |
|---|
| >PLN02702 L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd05281 TDH Threonine dehydrogenase | Back alignment and domain information |
|---|
| >PRK05396 tdh L-threonine 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1196|consensus | Back alignment and domain information |
|---|
| >PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG1201|consensus | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PF10686 DUF2493: Protein of unknown function (DUF2493); InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61 | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1205|consensus | Back alignment and domain information |
|---|
| >COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >KOG1200|consensus | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >KOG1208|consensus | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >PF13580 SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_A 3BJZ_D 2XBL_B 2X3Y_F 2YVA_B 3CVJ_D 3TRJ_D | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG1252|consensus | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >KOG1210|consensus | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2862|consensus | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >KOG1610|consensus | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >KOG1203|consensus | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 121 | ||||
| 2vz8_A | 2512 | Crystal Structure Of Mammalian Fatty Acid Synthase | 3e-43 | ||
| 3slk_A | 795 | Structure Of Ketoreductase And Enoylreductase Didom | 2e-17 | ||
| 1pqw_A | 198 | Putative Enoyl Reductase Domain Of Polyketide Synth | 2e-09 | ||
| 4a27_A | 349 | Crystal Structure Of Human Synaptic Vesicle Membran | 5e-09 | ||
| 1yb5_A | 351 | Crystal Structure Of Human Zeta-crystallin With Bou | 3e-06 | ||
| 3tqh_A | 321 | Structure Of The Quinone Oxidoreductase From Coxiel | 3e-06 | ||
| 2oby_A | 338 | Crystal Structure Of Human P53 Inducible Oxidoreduc | 3e-06 | ||
| 2j8z_A | 354 | Crystal Structure Of Human P53 Inducible Oxidoreduc | 4e-06 | ||
| 4dup_A | 353 | Crystal Structure Of A Quinone Oxidoreductase From | 6e-06 | ||
| 1iyz_A | 302 | Crystal Structures Of The Quinone Oxidoreductase Fr | 2e-05 | ||
| 2cf2_D | 295 | Architecture Of Mammalian Fatty Acid Synthase Lengt | 2e-05 | ||
| 3gaz_A | 343 | Crystal Structure Of An Alcohol Dehydrogenase Super | 2e-05 | ||
| 1zsy_A | 357 | The Structure Of Human Mitochondrial 2-Enoyl Thioes | 3e-05 | ||
| 2vcy_A | 344 | Crystal Structure Of 2-Enoyl Thioester Reductase Of | 3e-05 | ||
| 2eih_A | 343 | Crystal Structure Of Nad-Dependent Alcohol Dehydrog | 6e-05 | ||
| 1wly_A | 333 | Crystal Structure Of 2-haloacrylate Reductase Lengt | 4e-04 | ||
| 2wek_A | 341 | Crystal Structure Of The Human Mgc45594 Gene Produc | 5e-04 | ||
| 2x7h_A | 370 | Crystal Structure Of The Human Mgc45594 Gene Produc | 5e-04 | ||
| 2c0c_A | 362 | Structure Of The Mgc45594 Gene Product Length = 362 | 6e-04 | ||
| 3meq_A | 365 | Crystal Structure Of Alcohol Dehydrogenase From Bru | 7e-04 | ||
| 1iz0_A | 302 | Crystal Structures Of The Quinone Oxidoreductase Fr | 7e-04 |
| >pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 | Back alignment and structure |
|
| >pdb|3SLK|A Chain A, Structure Of Ketoreductase And Enoylreductase Didomain From Modular Polyketide Synthase Length = 795 | Back alignment and structure |
| >pdb|1PQW|A Chain A, Putative Enoyl Reductase Domain Of Polyketide Synthase Length = 198 | Back alignment and structure |
| >pdb|4A27|A Chain A, Crystal Structure Of Human Synaptic Vesicle Membrane Protein Vat-1 Homolog-Like Protein Length = 349 | Back alignment and structure |
| >pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 | Back alignment and structure |
| >pdb|3TQH|A Chain A, Structure Of The Quinone Oxidoreductase From Coxiella Burnetii Length = 321 | Back alignment and structure |
| >pdb|2OBY|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase (Tp53i3,Pig3) Length = 338 | Back alignment and structure |
| >pdb|2J8Z|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase ( Tp53i3,Pig3) Length = 354 | Back alignment and structure |
| >pdb|4DUP|A Chain A, Crystal Structure Of A Quinone Oxidoreductase From Rhizobium Etli Cfn 42 Length = 353 | Back alignment and structure |
| >pdb|1IYZ|A Chain A, Crystal Structures Of The Quinone Oxidoreductase From Thermus Thermophilus Hb8 And Its Complex With Nadph Length = 302 | Back alignment and structure |
| >pdb|2CF2|D Chain D, Architecture Of Mammalian Fatty Acid Synthase Length = 295 | Back alignment and structure |
| >pdb|3GAZ|A Chain A, Crystal Structure Of An Alcohol Dehydrogenase Superfamily Protein From Novosphingobium Aromaticivorans Length = 343 | Back alignment and structure |
| >pdb|1ZSY|A Chain A, The Structure Of Human Mitochondrial 2-Enoyl Thioester Reductase (Cgi- 63) Length = 357 | Back alignment and structure |
| >pdb|2VCY|A Chain A, Crystal Structure Of 2-Enoyl Thioester Reductase Of Human Fas Ii Length = 344 | Back alignment and structure |
| >pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 | Back alignment and structure |
| >pdb|1WLY|A Chain A, Crystal Structure Of 2-haloacrylate Reductase Length = 333 | Back alignment and structure |
| >pdb|2WEK|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Diclofenac Length = 341 | Back alignment and structure |
| >pdb|2X7H|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Fenoprofen Length = 370 | Back alignment and structure |
| >pdb|2C0C|A Chain A, Structure Of The Mgc45594 Gene Product Length = 362 | Back alignment and structure |
| >pdb|3MEQ|A Chain A, Crystal Structure Of Alcohol Dehydrogenase From Brucella Mel Length = 365 | Back alignment and structure |
| >pdb|1IZ0|A Chain A, Crystal Structures Of The Quinone Oxidoreductase From Thermus Thermophilus Hb8 And Its Complex With Nadph Length = 302 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 121 | |||
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 6e-50 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 1e-37 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 4e-32 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 7e-26 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 1e-25 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 2e-25 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 2e-25 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 7e-25 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 7e-22 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 2e-21 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 3e-21 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 4e-21 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 5e-21 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 4e-20 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 3e-19 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 9e-19 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 6e-18 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 1e-17 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 1e-17 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 1e-16 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 3e-16 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 5e-15 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 1e-13 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 2e-13 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 1e-12 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 6e-12 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 8e-12 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 9e-12 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 2e-11 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 3e-10 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 2e-07 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 3e-06 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 4e-06 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 2e-05 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 8e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 |
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 | Back alignment and structure |
|---|
Score = 168 bits (428), Expect = 6e-50
Identities = 77/121 (63%), Positives = 100/121 (82%)
Query: 1 MLASGKLPPDALPGDLAGQDCVLGLEFSGRDTKGRRVMGLVAARSLATTVLADPSFLWEV 60
MLA+GKL PD++PG +DC+LG+EFSGRD GRRVMG+V A LAT+VL WEV
Sbjct: 1577 MLATGKLSPDSIPGKWLTRDCMLGMEFSGRDASGRRVMGMVPAEGLATSVLLLQHATWEV 1636
Query: 61 PAKWTLEEASTIPVVYATAYYSLIVRGKMRPGESLLVHAGAGGLGQAAISIALHMGCTVY 120
P+ WTLEEA+++P+VY TAYYSL+VRG+M+PGES+L+H+G+GG+GQAAI+IAL GC V+
Sbjct: 1637 PSTWTLEEAASVPIVYTTAYYSLVVRGRMQPGESVLIHSGSGGVGQAAIAIALSRGCRVF 1696
Query: 121 T 121
T
Sbjct: 1697 T 1697
|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 | Back alignment and structure |
|---|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Length = 345 | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Length = 333 | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 99.95 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 99.95 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 99.95 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 99.94 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 99.94 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 99.94 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 99.94 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 99.94 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 99.94 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 99.93 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 99.93 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 99.93 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 99.93 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 99.93 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 99.93 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 99.93 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 99.93 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 99.93 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 99.93 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 99.93 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 99.93 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 99.92 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 99.92 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 99.92 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 99.92 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 99.92 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 99.92 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 99.92 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 99.92 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 99.92 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 99.92 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 99.92 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 99.92 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 99.92 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 99.92 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 99.92 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 99.91 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 99.91 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 99.91 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 99.91 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 99.91 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 99.91 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 99.91 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 99.91 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 99.91 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 99.91 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 99.91 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 99.91 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 99.91 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 99.91 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 99.91 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 99.91 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 99.9 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 99.9 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 99.9 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 99.9 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 99.9 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 99.9 | |
| 4eez_A | 348 | Alcohol dehydrogenase 1; site-saturation mutagenes | 99.9 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 99.89 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 99.89 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 99.89 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 99.88 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 99.88 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 99.88 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 99.88 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 99.88 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 99.87 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 99.87 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 99.86 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 99.54 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 97.29 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 96.59 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 96.2 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 96.19 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 96.16 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 96.14 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 96.13 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 96.1 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 96.04 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 96.03 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 96.02 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 96.0 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 95.97 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 95.96 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 95.95 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 95.94 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 95.94 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 95.93 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 95.92 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 95.92 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 95.92 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 95.91 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 95.91 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 95.89 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 95.87 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 95.87 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 95.87 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 95.85 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 95.85 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 95.85 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 95.84 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 95.84 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 95.84 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.83 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 95.83 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 95.83 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 95.83 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 95.82 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 95.82 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 95.81 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.81 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 95.81 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 95.79 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 95.79 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 95.79 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 95.79 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 95.78 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 95.78 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 95.77 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 95.77 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 95.76 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 95.75 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 95.75 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 95.74 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 95.73 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 95.73 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 95.73 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 95.73 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.72 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 95.72 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 95.72 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 95.71 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 95.7 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 95.69 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 95.68 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 95.67 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 95.67 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 95.66 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 95.64 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 95.64 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 95.64 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 95.63 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 95.62 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 95.55 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 95.55 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 95.53 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 95.53 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 95.53 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 95.52 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 95.52 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 95.49 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 95.47 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 95.47 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 95.42 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 95.39 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 95.37 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 95.36 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 95.3 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 95.24 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 95.23 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 95.23 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 95.18 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 95.17 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 95.13 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 95.02 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 95.01 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 95.0 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 95.0 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 94.95 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 94.9 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 94.9 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 94.84 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 94.84 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 94.79 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 94.77 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 94.76 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 94.73 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 94.73 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 94.71 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 94.71 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 94.7 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 94.63 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 94.61 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 94.61 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 94.6 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 94.59 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 94.48 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 94.47 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 94.39 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 94.35 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 94.34 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 94.31 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 94.17 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 94.15 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 94.15 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 94.11 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 94.1 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 93.92 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 93.91 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 93.87 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 93.81 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 93.72 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 93.6 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 93.6 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 93.57 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 93.57 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 93.5 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 93.43 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 93.39 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 93.39 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 93.34 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 93.2 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 93.18 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 93.14 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 92.95 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 92.9 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 92.89 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 92.88 | |
| 4ggo_A | 401 | Trans-2-enoyl-COA reductase; rossmann fold, oxidor | 92.85 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 92.79 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 92.62 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 92.52 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 92.48 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 92.08 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 91.83 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 91.8 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 91.63 | |
| 4fcc_A | 450 | Glutamate dehydrogenase; protein complex, rossmann | 91.46 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 91.36 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 91.28 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 91.28 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 90.78 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 90.73 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 89.69 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 89.55 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 89.53 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 89.18 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 89.15 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 89.12 | |
| 3mw9_A | 501 | GDH 1, glutamate dehydrogenase 1; allostery, inhib | 88.98 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 88.9 | |
| 3k92_A | 424 | NAD-GDH, NAD-specific glutamate dehydrogenase; ROC | 88.88 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 88.76 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 88.74 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 88.71 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 88.51 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 88.47 | |
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 88.36 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 88.24 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 88.11 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 88.08 | |
| 2bma_A | 470 | Glutamate dehydrogenase (NADP+); malaria, drug des | 87.98 | |
| 1v9l_A | 421 | Glutamate dehydrogenase; protein-NAD complex, oxid | 87.8 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 87.78 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 87.7 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 87.68 | |
| 3r3j_A | 456 | Glutamate dehydrogenase; rossman fold, oxidoreduct | 87.54 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 87.5 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 87.37 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 87.18 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 86.98 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 86.97 | |
| 2yfq_A | 421 | Padgh, NAD-GDH, NAD-specific glutamate dehydrogena | 86.84 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 86.7 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 86.69 | |
| 2tmg_A | 415 | Protein (glutamate dehydrogenase); metabolic role, | 86.59 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 86.56 | |
| 1bgv_A | 449 | Glutamate dehydrogenase; oxidoreductase; HET: GLU; | 86.49 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 86.49 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 86.29 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 86.29 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 86.2 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 86.07 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 86.04 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 85.47 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 85.37 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 85.35 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 85.3 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 85.17 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 84.94 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 84.92 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 84.77 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 84.76 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 84.7 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 84.66 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 84.6 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 84.57 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 84.5 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 84.42 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 84.32 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 84.08 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 84.01 | |
| 2we8_A | 386 | Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc | 84.0 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 83.85 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 83.59 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 83.44 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 83.43 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 83.17 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 83.1 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 83.07 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 82.89 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 82.7 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 81.73 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 81.59 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 81.55 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 81.13 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 80.99 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 80.89 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 80.81 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 80.74 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 80.57 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 80.35 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 80.05 |
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
Probab=99.95 E-value=5.7e-27 Score=169.49 Aligned_cols=102 Identities=19% Similarity=0.240 Sum_probs=96.5
Q ss_pred CCCCccCcceEEEE----------ccCCEEEEEcc---CCceeEEEEeCCCCeEEcCCCCCHHHHhhcchHHHHHHHHHH
Q psy3430 18 GQDCVLGLEFSGRD----------TKGRRVMGLVA---ARSLATTVLADPSFLWEVPAKWTLEEASTIPVVYATAYYSLI 84 (121)
Q Consensus 18 ~~~~~~G~e~~G~V----------~~Gd~V~~~~~---~g~~~~~~~v~~~~~~~~p~~~~~~~aa~l~~~~~ta~~~l~ 84 (121)
.+|.++|||++|+| ++||||++... +|+|+||++++++.++++|+++++++|+++++++.|||+++
T Consensus 57 ~~p~i~G~e~~G~V~~vG~~v~~~~vGdrV~~~~~~~~~G~~aey~~v~~~~~~~iP~~~~~~~aa~l~~~~~ta~~al- 135 (315)
T 3goh_A 57 SNGHVPGVDGAGVIVKVGAKVDSKMLGRRVAYHTSLKRHGSFAEFTVLNTDRVMTLPDNLSFERAAALPCPLLTAWQAF- 135 (315)
T ss_dssp CTTCCCCSEEEEEEEEECTTSCGGGTTCEEEEECCTTSCCSSBSEEEEETTSEEECCTTSCHHHHHTSHHHHHHHHHHH-
T ss_pred CCCCEeeeeeEEEEEEeCCCCCCCCCCCEEEEeCCCCCCcccccEEEEcHHHhccCcCCCCHHHHhhCccHHHHHHHHH-
Confidence 56899999999998 78999998753 69999999999999999999999999999999999999999
Q ss_pred hhcCCCCCCEEEEecCCchHHHHHHHHHHHCCCEEeC
Q psy3430 85 VRGKMRPGESLLVHAGAGGLGQAAISIALHMGCTVYT 121 (121)
Q Consensus 85 ~~~~~~~g~~vli~ga~g~vG~~aiqla~~~G~~vi~ 121 (121)
+..++++||+|||+|+ |++|++++|+||.+|++|++
T Consensus 136 ~~~~~~~g~~VlV~Ga-G~vG~~a~qlak~~Ga~Vi~ 171 (315)
T 3goh_A 136 EKIPLTKQREVLIVGF-GAVNNLLTQMLNNAGYVVDL 171 (315)
T ss_dssp TTSCCCSCCEEEEECC-SHHHHHHHHHHHHHTCEEEE
T ss_pred hhcCCCCCCEEEEECC-CHHHHHHHHHHHHcCCEEEE
Confidence 9999999999999998 99999999999999999874
|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 121 | ||||
| d1gu7a2 | 189 | c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yea | 5e-10 | |
| d1qora2 | 179 | c.2.1.1 (A:113-291) Quinone oxidoreductase {Escher | 9e-10 | |
| d1pqwa_ | 183 | c.2.1.1 (A:) Putative enoyl reductase domain of po | 1e-09 | |
| d2jhfa2 | 176 | c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( | 4e-08 | |
| d1v3va2 | 182 | c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehyd | 7e-08 | |
| d1tt7a1 | 162 | b.35.1.2 (A:2-127,A:295-330) Hypothetical protein | 1e-07 | |
| d2fzwa2 | 176 | c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( | 2e-07 | |
| d1vj1a2 | 187 | c.2.1.1 (A:125-311) Putative zinc-binding alcohol | 2e-07 | |
| d1iz0a1 | 131 | b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase | 4e-07 | |
| d1kola2 | 195 | c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps | 5e-07 | |
| d1gu7a1 | 175 | b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu | 6e-07 | |
| d1cdoa1 | 199 | b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase | 8e-07 | |
| d1xa0a2 | 176 | c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Ba | 1e-06 | |
| d1e3ia2 | 174 | c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( | 1e-06 | |
| d1yb5a2 | 174 | c.2.1.1 (A:121-294) Quinone oxidoreductase {Human | 1e-06 | |
| d1d1ta2 | 176 | c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( | 2e-06 | |
| d1vj0a2 | 182 | c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T | 3e-06 | |
| d1p0fa2 | 174 | c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog | 4e-06 | |
| d1cdoa2 | 175 | c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga | 4e-06 | |
| d1iz0a2 | 171 | c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus | 6e-06 | |
| d1jqba2 | 174 | c.2.1.1 (A:1140-1313) Bacterial secondary alcohol | 1e-05 | |
| d1kola1 | 201 | b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog | 1e-05 | |
| d1f8fa2 | 174 | c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { | 1e-05 | |
| d1rjwa2 | 168 | c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillu | 3e-05 | |
| d1tt7a2 | 167 | c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bac | 7e-05 | |
| d1pl8a1 | 185 | b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor | 8e-05 | |
| d1llua2 | 166 | c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudom | 8e-05 | |
| d1piwa1 | 192 | b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy | 1e-04 | |
| d2fzwa1 | 197 | b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase | 1e-04 | |
| d1xa0a1 | 152 | b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo | 3e-04 | |
| d1h2ba2 | 172 | c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeo | 4e-04 | |
| d1qora1 | 147 | b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductas | 4e-04 | |
| d1jvba2 | 170 | c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeo | 5e-04 | |
| d1e3ja1 | 178 | b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor | 5e-04 | |
| d1o8ca2 | 77 | c.2.1.1 (A:116-192) Hypothetical protein YhdH {Esc | 6e-04 | |
| d1yb5a1 | 150 | b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductas | 0.001 | |
| d1f8fa1 | 194 | b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr | 0.001 | |
| d1h2ba1 | 171 | b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas | 0.002 | |
| d1piwa2 | 168 | c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase | 0.002 | |
| d1pl8a2 | 171 | c.2.1.1 (A:146-316) Ketose reductase (sorbitol deh | 0.003 |
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 189 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Alcohol dehydrogenase-like, C-terminal domain domain: 2,4-dienoyl-CoA reductase species: Yeast (Candida tropicalis) [TaxId: 5482]
Score = 52.3 bits (124), Expect = 5e-10
Identities = 15/57 (26%), Positives = 24/57 (42%), Gaps = 1/57 (1%)
Query: 65 TLEEASTIPVVYATAYYSLIVRGKMRPGESLLVH-AGAGGLGQAAISIALHMGCTVY 120
T+ + +TI V TAY L K+ PG+ + G +G+ A I +
Sbjct: 2 TINQGATISVNPLTAYLMLTHYVKLTPGKDWFIQNGGTSAVGKYASQIGKLLNFNSI 58
|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 183 | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 182 | Back information, alignment and structure |
|---|
| >d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 187 | Back information, alignment and structure |
|---|
| >d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 | Back information, alignment and structure |
|---|
| >d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 | Back information, alignment and structure |
|---|
| >d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 176 | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 171 | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 | Back information, alignment and structure |
|---|
| >d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 167 | Back information, alignment and structure |
|---|
| >d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 | Back information, alignment and structure |
|---|
| >d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 | Back information, alignment and structure |
|---|
| >d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 | Back information, alignment and structure |
|---|
| >d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 172 | Back information, alignment and structure |
|---|
| >d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 147 | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 170 | Back information, alignment and structure |
|---|
| >d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 77 | Back information, alignment and structure |
|---|
| >d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 | Back information, alignment and structure |
|---|
| >d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 168 | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| d1iz0a1 | 131 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 99.81 | |
| d1e3ja1 | 178 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 99.78 | |
| d1yb5a1 | 150 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 99.75 | |
| d1h2ba1 | 171 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 99.71 | |
| d1xa0a1 | 152 | B. subtilis YhfP homologue {Bacillus stearothermop | 99.7 | |
| d1piwa1 | 192 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 99.68 | |
| d1qora1 | 147 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 99.68 | |
| d1llua1 | 175 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 99.65 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 99.64 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 99.64 | |
| d1cdoa1 | 199 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 99.64 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 99.62 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 99.6 | |
| d1tt7a1 | 162 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 99.58 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 99.57 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.57 | |
| d1pl8a1 | 185 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 99.56 | |
| d1rjwa1 | 171 | Alcohol dehydrogenase {Bacillus stearothermophilus | 99.56 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 99.54 | |
| d1o89a1 | 146 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.53 | |
| d1kola1 | 201 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 99.53 | |
| d1f8fa1 | 194 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 99.53 | |
| d1gu7a1 | 175 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 99.53 | |
| d2fzwa1 | 197 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 99.51 | |
| d1e3ia1 | 202 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 99.51 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 99.5 | |
| d1vj0a1 | 184 | Hypothetical protein TM0436 {Thermotoga maritima [ | 99.49 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 99.48 | |
| d1jvba1 | 177 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 99.48 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.46 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 99.44 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 99.43 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 99.42 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 99.42 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 99.39 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 99.39 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 99.39 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 99.37 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 99.37 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 99.37 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 99.35 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 99.32 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 99.29 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 99.27 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 99.26 | |
| d2jhfa1 | 198 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 99.19 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 99.18 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 99.17 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 99.16 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 99.1 | |
| d1uufa1 | 179 | Hypothetical protein YahK {Escherichia coli [TaxId | 99.02 | |
| d1jqba1 | 177 | Bacterial secondary alcohol dehydrogenase {Clostri | 98.95 | |
| d1p0fa1 | 198 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 98.87 | |
| d1vj1a1 | 166 | Putative zinc-binding alcohol dehydrogenase {Mouse | 98.87 | |
| d1v3va1 | 147 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 98.82 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 96.93 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 96.57 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 96.51 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 96.39 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 96.21 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 95.89 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 95.39 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 95.2 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 94.57 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 94.52 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 94.25 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 93.71 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 93.53 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 93.44 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 93.38 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 93.34 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 93.34 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 93.25 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 93.14 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 93.12 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 93.09 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 93.06 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 92.91 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 92.69 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 92.65 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 92.61 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 92.43 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 92.31 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 92.27 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 92.19 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 91.92 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 91.67 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 91.26 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 90.98 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 90.89 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 90.62 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 90.39 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 90.09 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 90.04 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 89.41 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 89.34 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 89.25 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 89.13 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 88.88 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 88.55 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 88.54 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 88.52 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 88.26 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 87.87 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 87.84 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 87.57 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 87.27 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 86.87 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 86.36 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 86.14 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 86.1 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 85.86 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 85.54 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 85.02 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 84.83 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 83.71 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 83.24 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 83.17 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 82.65 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 82.24 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 82.0 | |
| d1zn7a1 | 178 | Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] | 81.58 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 81.57 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 80.75 |
| >d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: GroES-like superfamily: GroES-like family: Alcohol dehydrogenase-like, N-terminal domain domain: Quinone oxidoreductase species: Thermus thermophilus [TaxId: 274]
Probab=99.81 E-value=3.8e-21 Score=122.37 Aligned_cols=77 Identities=23% Similarity=0.290 Sum_probs=71.6
Q ss_pred CCCCccCcceEEEEccCCEEEEEccCCceeEEEEeCCCCeEEcCCCCCHHHHhhcchHHHHHHHHHHhhcCCCCCCEEEE
Q psy3430 18 GQDCVLGLEFSGRDTKGRRVMGLVAARSLATTVLADPSFLWEVPAKWTLEEASTIPVVYATAYYSLIVRGKMRPGESLLV 97 (121)
Q Consensus 18 ~~~~~~G~e~~G~V~~Gd~V~~~~~~g~~~~~~~v~~~~~~~~p~~~~~~~aa~l~~~~~ta~~~l~~~~~~~~g~~vli 97 (121)
.+|+++|+|++|+| +||+|+++..+|+|+||++++++.++++|+++|+++|+++++++.|||++|.+.+ +.|++||+
T Consensus 54 ~~P~v~G~E~~G~V-vGd~V~~~~~~G~~aey~~v~~~~~~~~P~~~~~~~aa~~~~~~~Ta~~al~~~g--~~g~tvl~ 130 (131)
T d1iz0a1 54 HPPFIPGMEVVGVV-EGRRYAALVPQGGLAERVAVPKGALLPLPEGRPVVGPVFPFAEAEAAFRALLDRG--HTGKVVVR 130 (131)
T ss_dssp CSSBCCCCEEEEEE-TTEEEEEECSSCCSBSEEEEEGGGCEECCTTCCCEEEEEEGGGHHHHHHHTTCTT--CCBEEEEE
T ss_pred cceeEeeeeeEEee-ccceEEEEeccCccceeeeeCHHHeEEccCCCCHHHHHHHHHHHHHHHHHHHhcc--cCCCEEEE
Confidence 57899999999999 6999999999999999999999999999999999999999999999999997665 45999986
|
| >d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|