Diaphorina citri psyllid: psy3461


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MIPVKKNKDAGYGYHERQWQLLRRGRYVEFNLIYDRGTKFGLQTPGARYESILMSLPLTAKWEYMHTPEETSKEGQLIKILKNPKEW
cccccccccccccHHHHHHHHHHHccEEEEEEEECcccEEECccccccHHHHHHccccccccccccccccccHHHHHHHHHcccccc
*I****NKDAGYGYHERQWQLLRRGRYVEFNLIYDRGTKFGLQTPGARYESILMSLPLTAKWEYMHTPEETSKEGQLIKILKNPKEW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPVKKNKDAGYGYHERQWQLLRRGRYVEFNLIYDRGTKFGLQTPGARYESILMSLPLTAKWEYMHTPEETSKEGQLIKILKNPKEW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coproporphyrinogen-III oxidase Key enzyme in heme biosynthesis. Catalyzes the oxidative decarboxylation of propionic acid side chains of rings A and B of coproporphyrinogen III.confidentQ9V3D2
Coproporphyrinogen-III oxidase, aerobic Key enzyme in heme biosynthesis. Catalyzes the oxidative decarboxylation of propionic acid side chains of rings A and B of coproporphyrinogen III.confidentQ5N3S5
Coproporphyrinogen-III oxidase, aerobic Key enzyme in heme biosynthesis. Catalyzes the oxidative decarboxylation of propionic acid side chains of rings A and B of coproporphyrinogen III.confidentA2C524

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006783 [BP]heme biosynthetic processprobableGO:0006778, GO:0006779, GO:0044249, GO:0034641, GO:0006807, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0051186, GO:0042440, GO:0051188, GO:0071704, GO:0033014, GO:0033013, GO:0018130, GO:0042168, GO:0009987, GO:0006725, GO:0009058, GO:0008150, GO:0008152, GO:1901564, GO:0046148, GO:0046483, GO:0044271, GO:1901566, GO:0044237, GO:0019438
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030445 [CC]yeast-form cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0030145 [MF]manganese ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0004109 [MF]coproporphyrinogen oxidase activityprobableGO:0003824, GO:0016634, GO:0003674, GO:0016627, GO:0016491
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AEX, chain A
Confidence level:very confident
Coverage over the Query: 3-87
View the alignment between query and template
View the model in PyMOL