Diaphorina citri psyllid: psy3468


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPFRRNKTKH
cEEEEEccHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccc
MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIP*R******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPFRRNKTKH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome subunit alpha type-4 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentQ3ZCK9
Proteasome subunit alpha type-4 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentP25789
Proteasome subunit alpha type-4 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentP18053

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000084 [BP]S phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0022626 [CC]cytosolic ribosomeprobableGO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0034515 [CC]proteasome storage granuleprobableGO:0043234, GO:0005737, GO:0032991, GO:0044445, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0031597, GO:0044424, GO:0000502
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0001673 [CC]male germ cell nucleusprobableGO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0016071 [BP]mRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0000216 [BP]M/G1 transition of mitotic cell cycleprobable
GO:0031145 [BP]anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0006977 [BP]DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrestprobableGO:0051726, GO:0044699, GO:0010948, GO:0044773, GO:0044774, GO:0007165, GO:0035556, GO:0072331, GO:0050789, GO:0072401, GO:0090068, GO:0051716, GO:2000134, GO:0031570, GO:0031571, GO:0072395, GO:0010564, GO:0071158, GO:0065007, GO:1901988, GO:0048518, GO:0048519, GO:0071156, GO:1901990, GO:0030330, GO:0008150, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0044763, GO:0023052, GO:0007154, GO:0072413, GO:0042770, GO:0044700, GO:0007049, GO:0000077, GO:2000045, GO:0000075, GO:0072431, GO:0022402, GO:0072422, GO:0033554, GO:1901991, GO:0044783, GO:0007093, GO:0050896, GO:0048523, GO:0048522
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0051437 [BP]positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycleprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051439, GO:0051438, GO:0050789, GO:0007049, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044699, GO:0031398, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0043085, GO:0009987, GO:0000278, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0044763, GO:0032268, GO:0051443, GO:0022402, GO:0031401, GO:0051351, GO:0008150, GO:0044093, GO:0048522
GO:0051436 [BP]negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycleprobableGO:0009892, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0022402, GO:0051438, GO:0043086, GO:0044699, GO:0051248, GO:0051340, GO:0010605, GO:0051246, GO:0050789, GO:0065007, GO:0007049, GO:0044092, GO:0031396, GO:0031397, GO:0065009, GO:0009987, GO:0000278, GO:0060255, GO:0051439, GO:0050790, GO:0050794, GO:0044763, GO:0048519, GO:0051444, GO:0032269, GO:0032268, GO:0031400, GO:0051352, GO:0008150, GO:0048523
GO:0000022 [BP]mitotic spindle elongationprobableGO:0006996, GO:0044699, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0000226, GO:0008150, GO:0007051, GO:0007052, GO:0022402, GO:0007049, GO:0044763, GO:0051231, GO:0016043
GO:0010499 [BP]proteasomal ubiquitin-independent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0010498, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0044238, GO:0009057
GO:0002479 [BP]antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependentprobableGO:0002474, GO:0019882, GO:0019884, GO:0002478, GO:0002376, GO:0042590, GO:0008150, GO:0048002
GO:0010467 [BP]gene expressionprobableGO:0071704, GO:0008150, GO:0008152, GO:0043170
GO:0004298 [MF]threonine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070003, GO:0070011, GO:0003674, GO:0008233
GO:0019773 [CC]proteasome core complex, alpha-subunit complexprobableGO:0043234, GO:0032991, GO:0005839, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704
GO:0006521 [BP]regulation of cellular amino acid metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0010565, GO:0050794, GO:0033238, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IRU, chain C
Confidence level:very confident
Coverage over the Query: 1-66
View the alignment between query and template
View the model in PyMOL