Psyllid ID: psy3468

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------
MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPFRRNKTKH
cEEEEEccHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccc
ccEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHEccccccccccccccc
MVCSVAGITSDANVLTSELRAIAQRYLIqynepipceQLVACLCDikqgytqyggqsiipfrrnktkh
mvcsvagitsdanvLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYtqyggqsiipfrrnktkh
MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPFRRNKTKH
****VAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPF*******
MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSI***R******
********TSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPFRRNKTKH
MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIP********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPFRRNKTKH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query68 2.2.26 [Sep-21-2011]
Q9R1P0 261 Proteasome subunit alpha yes N/A 0.867 0.226 0.786 4e-22
P21670 261 Proteasome subunit alpha yes N/A 0.867 0.226 0.786 4e-22
P25789 261 Proteasome subunit alpha yes N/A 0.867 0.226 0.786 4e-22
Q3ZCK9 261 Proteasome subunit alpha yes N/A 0.867 0.226 0.786 4e-22
Q4R932 261 Proteasome subunit alpha N/A N/A 0.867 0.226 0.786 4e-22
P18053 264 Proteasome subunit alpha yes N/A 0.867 0.223 0.786 3e-20
P34119 250 Proteasome subunit alpha yes N/A 0.808 0.22 0.636 1e-15
Q09682 248 Probable proteasome subun yes N/A 0.867 0.237 0.573 3e-15
Q5VRG3 250 Proteasome subunit alpha yes N/A 0.808 0.22 0.636 5e-15
P0C8Y9 250 Proteasome subunit alpha N/A N/A 0.808 0.22 0.636 5e-15
>sp|Q9R1P0|PSA4_MOUSE Proteasome subunit alpha type-4 OS=Mus musculus GN=Psma4 PE=1 SV=1 Back     alignment and function desciption
 Score =  103 bits (256), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 48/61 (78%), Positives = 52/61 (85%), Gaps = 2/61 (3%)

Query: 1   MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIP 60
           M CSVAGITSDANVLT+ELR IAQRYL+QY EPIPCEQLV  LCDIKQ YTQ+GG+   P
Sbjct: 72  MACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKR--P 129

Query: 61  F 61
           F
Sbjct: 130 F 130
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|P21670|PSA4_RAT Proteasome subunit alpha type-4 OS=Rattus norvegicus GN=Psma4 PE=1 SV=1 Back     alignment and function description
>sp|P25789|PSA4_HUMAN Proteasome subunit alpha type-4 OS=Homo sapiens GN=PSMA4 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZCK9|PSA4_BOVIN Proteasome subunit alpha type-4 OS=Bos taurus GN=PSMA4 PE=1 SV=1 Back     alignment and function description
>sp|Q4R932|PSA4_MACFA Proteasome subunit alpha type-4 OS=Macaca fascicularis GN=PSMA4 PE=2 SV=1 Back     alignment and function description
>sp|P18053|PSA4_DROME Proteasome subunit alpha type-4 OS=Drosophila melanogaster GN=Pros29 PE=1 SV=2 Back     alignment and function description
>sp|P34119|PSA4_DICDI Proteasome subunit alpha type-4 OS=Dictyostelium discoideum GN=psmA4 PE=2 SV=1 Back     alignment and function description
>sp|Q09682|PSA3_SCHPO Probable proteasome subunit alpha type-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.01c PE=3 SV=1 Back     alignment and function description
>sp|Q5VRG3|PSA4B_ORYSJ Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. japonica GN=Os06g0167600 PE=2 SV=1 Back     alignment and function description
>sp|P0C8Y9|PSA4B_ORYSI Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. indica GN=OsI_021067 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
326926468 635 PREDICTED: aminoglycoside phosphotransfe 0.867 0.092 0.786 3e-21
392878408 261 proteasome alpha 4 subunit [Callorhinchu 0.867 0.226 0.803 6e-21
350409351 642 PREDICTED: hypothetical protein LOC10074 0.867 0.091 0.786 6e-21
380011487 528 PREDICTED: uncharacterized protein LOC10 0.867 0.111 0.786 8e-21
213510924 261 Proteasome subunit alpha type-4 [Salmo s 0.867 0.226 0.786 8e-21
209733720 261 Proteasome subunit alpha type-4 [Salmo s 0.867 0.226 0.786 8e-21
197632223 261 proteasome (prosome, macropain) subunit, 0.867 0.226 0.786 9e-21
225704204 261 Proteasome subunit alpha type 4 [Oncorhy 0.867 0.226 0.786 9e-21
209735488 261 Proteasome subunit alpha type-4 [Salmo s 0.867 0.226 0.786 9e-21
225716624 261 Proteasome subunit alpha type-4 [Esox lu 0.867 0.226 0.786 1e-20
>gi|326926468|ref|XP_003209422.1| PREDICTED: aminoglycoside phosphotransferase domain-containing protein 1-like [Meleagris gallopavo] Back     alignment and taxonomy information
 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/61 (78%), Positives = 52/61 (85%), Gaps = 2/61 (3%)

Query: 1   MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIP 60
           M CSVAGITSDANVLT+ELR IAQRYL+QY EPIPCEQLV  LCDIKQ YTQ+GG+   P
Sbjct: 446 MACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKR--P 503

Query: 61  F 61
           F
Sbjct: 504 F 504

Source: Meleagris gallopavo

Species: Meleagris gallopavo

Genus: Meleagris

Family: Phasianidae

Order: Galliformes

Class: Aves

Phylum: Chordata

Superkingdom: Eukaryota
>gi|392878408|gb|AFM88036.1| proteasome alpha 4 subunit [Callorhinchus milii] Back     alignment and taxonomy information
>gi|350409351|ref|XP_003488705.1| PREDICTED: hypothetical protein LOC100745131 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380011487|ref|XP_003689834.1| PREDICTED: uncharacterized protein LOC100870087 [Apis florea] Back     alignment and taxonomy information
>gi|213510924|ref|NP_001134515.1| Proteasome subunit alpha type-4 [Salmo salar] gi|209733934|gb|ACI67836.1| Proteasome subunit alpha type-4 [Salmo salar] Back     alignment and taxonomy information
>gi|209733720|gb|ACI67729.1| Proteasome subunit alpha type-4 [Salmo salar] Back     alignment and taxonomy information
>gi|197632223|gb|ACH70835.1| proteasome (prosome, macropain) subunit, alpha type, 4 [Salmo salar] gi|209734114|gb|ACI67926.1| Proteasome subunit alpha type-4 [Salmo salar] gi|225704770|gb|ACO08231.1| Proteasome subunit alpha type 4 [Oncorhynchus mykiss] Back     alignment and taxonomy information
>gi|225704204|gb|ACO07948.1| Proteasome subunit alpha type 4 [Oncorhynchus mykiss] Back     alignment and taxonomy information
>gi|209735488|gb|ACI68613.1| Proteasome subunit alpha type-4 [Salmo salar] Back     alignment and taxonomy information
>gi|225716624|gb|ACO14158.1| Proteasome subunit alpha type-4 [Esox lucius] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
UNIPROTKB|F1NC02 261 PSMA4 "Proteasome subunit alph 0.867 0.226 0.786 3.9e-21
UNIPROTKB|Q3ZCK9 261 PSMA4 "Proteasome subunit alph 0.867 0.226 0.786 3.9e-21
UNIPROTKB|H0YKT8182 PSMA4 "Proteasome subunit beta 0.867 0.324 0.786 3.9e-21
UNIPROTKB|H0YL69236 PSMA4 "Proteasome subunit alph 0.867 0.25 0.786 3.9e-21
UNIPROTKB|H0YLC2174 PSMA4 "Proteasome subunit alph 0.867 0.339 0.786 3.9e-21
UNIPROTKB|H0YMA1209 PSMA4 "Proteasome subunit alph 0.867 0.282 0.786 3.9e-21
UNIPROTKB|H0YMZ1221 PSMA4 "Proteasome subunit alph 0.867 0.266 0.786 3.9e-21
UNIPROTKB|H0YN18 230 PSMA4 "Proteasome subunit alph 0.867 0.256 0.786 3.9e-21
UNIPROTKB|P25789 261 PSMA4 "Proteasome subunit alph 0.867 0.226 0.786 3.9e-21
UNIPROTKB|F2Z528 261 PSMA4 "Proteasome subunit alph 0.867 0.226 0.786 3.9e-21
UNIPROTKB|F1NC02 PSMA4 "Proteasome subunit alpha type" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 3.9e-21, P = 3.9e-21
 Identities = 48/61 (78%), Positives = 52/61 (85%)

Query:     1 MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIP 60
             M CSVAGITSDANVLT+ELR IAQRYL+QY EPIPCEQLV  LCDIKQ YTQ+GG+   P
Sbjct:    72 MACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKR--P 129

Query:    61 F 61
             F
Sbjct:   130 F 130
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0019773 "proteasome core complex, alpha-subunit complex" evidence=IEA
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
UNIPROTKB|Q3ZCK9 PSMA4 "Proteasome subunit alpha type-4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H0YKT8 PSMA4 "Proteasome subunit beta type" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YL69 PSMA4 "Proteasome subunit alpha type" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YLC2 PSMA4 "Proteasome subunit alpha type" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YMA1 PSMA4 "Proteasome subunit alpha type" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YMZ1 PSMA4 "Proteasome subunit alpha type" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YN18 PSMA4 "Proteasome subunit alpha type-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P25789 PSMA4 "Proteasome subunit alpha type-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z528 PSMA4 "Proteasome subunit alpha type" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P18053PSA4_DROME3, ., 4, ., 2, 5, ., 10.78680.86760.2234yesN/A
Q9N599PSA4_CAEEL3, ., 4, ., 2, 5, ., 10.54230.83820.228yesN/A
Q5VRG3PSA4B_ORYSJ3, ., 4, ., 2, 5, ., 10.63630.80880.22yesN/A
P23638PSA3_YEAST3, ., 4, ., 2, 5, ., 10.54090.86760.2286yesN/A
P25789PSA4_HUMAN3, ., 4, ., 2, 5, ., 10.78680.86760.2260yesN/A
Q09682PSA3_SCHPO3, ., 4, ., 2, 5, ., 10.57370.86760.2379yesN/A
Q9R1P0PSA4_MOUSE3, ., 4, ., 2, 5, ., 10.78680.86760.2260yesN/A
O81148PSA4_ARATH3, ., 4, ., 2, 5, ., 10.61810.80880.22yesN/A
P34119PSA4_DICDI3, ., 4, ., 2, 5, ., 10.63630.80880.22yesN/A
P21670PSA4_RAT3, ., 4, ., 2, 5, ., 10.78680.86760.2260yesN/A
P0C1G8PSA4A_ORYSJ3, ., 4, ., 2, 5, ., 10.63630.80880.22yesN/A
Q3ZCK9PSA4_BOVIN3, ., 4, ., 2, 5, ., 10.78680.86760.2260yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
cd03752213 cd03752, proteasome_alpha_type_4, proteasome_alpha 2e-31
PTZ00246 253 PTZ00246, PTZ00246, proteasome subunit alpha; Prov 1e-20
cd01911209 cd01911, proteasome_alpha, proteasome alpha subuni 1e-19
cd03756211 cd03756, proteasome_alpha_archeal, proteasome_alph 6e-15
TIGR03633224 TIGR03633, arc_protsome_A, proteasome endopeptidas 1e-14
PRK03996241 PRK03996, PRK03996, proteasome subunit alpha; Prov 9e-14
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 6e-12
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 6e-12
pfam00227188 pfam00227, Proteasome, Proteasome subunit 7e-12
cd03750227 cd03750, proteasome_alpha_type_2, proteasome_alpha 2e-10
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 2e-07
cd03749211 cd03749, proteasome_alpha_type_1, proteasome_alpha 9e-07
cd03755207 cd03755, proteasome_alpha_type_7, proteasome_alpha 2e-06
cd03754215 cd03754, proteasome_alpha_type_6, proteasome_alpha 4e-05
cd03753213 cd03753, proteasome_alpha_type_5, proteasome_alpha 4e-05
cd03751212 cd03751, proteasome_alpha_type_3, proteasome_alpha 6e-04
>gnl|CDD|239721 cd03752, proteasome_alpha_type_4, proteasome_alpha_type_4 Back     alignment and domain information 
 Score =  107 bits (269), Expect = 2e-31
 Identities = 40/55 (72%), Positives = 44/55 (80%)

Query: 1   MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGG 55
           + C+VAGITSDAN+L +  R IAQRYL  Y EPIP EQLV  LCDIKQGYTQYGG
Sbjct: 70  IACAVAGITSDANILINYARLIAQRYLYSYQEPIPVEQLVQRLCDIKQGYTQYGG 124

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 213
>gnl|CDD|173491 PTZ00246, PTZ00246, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit Back     alignment and domain information
>gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal Back     alignment and domain information
>gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>gnl|CDD|235192 PRK03996, PRK03996, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|239719 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2 Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 Back     alignment and domain information
>gnl|CDD|239724 cd03755, proteasome_alpha_type_7, proteasome_alpha_type_7 Back     alignment and domain information
>gnl|CDD|239723 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6 Back     alignment and domain information
>gnl|CDD|239722 cd03753, proteasome_alpha_type_5, proteasome_alpha_type_5 Back     alignment and domain information
>gnl|CDD|239720 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 68
KOG0178|consensus 249 99.88
KOG0181|consensus233 99.87
KOG0183|consensus 249 99.86
KOG0182|consensus 246 99.82
KOG0863|consensus 264 99.78
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 99.78
KOG0184|consensus 254 99.77
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 99.76
COG0638 236 PRE1 20S proteasome, alpha and beta subunits [Post 99.76
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 99.76
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 99.76
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 99.75
KOG0176|consensus241 99.74
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 99.73
PTZ00246 253 proteasome subunit alpha; Provisional 99.69
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 99.69
PRK03996241 proteasome subunit alpha; Provisional 99.68
cd03765 236 proteasome_beta_bacterial Bacterial proteasome, be 99.67
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 99.67
TIGR03690 219 20S_bact_beta proteasome, beta subunit, bacterial 99.64
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 99.64
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 99.62
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 99.6
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 99.6
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 99.59
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 99.56
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 99.55
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 99.54
cd03757 212 proteasome_beta_type_1 proteasome beta type-1 subu 99.53
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 99.53
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 99.5
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 99.49
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 99.49
TIGR03691 228 20S_bact_alpha proteasome, alpha subunit, bacteria 99.49
PTZ00488 247 Proteasome subunit beta type-5; Provisional 99.42
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 99.4
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 99.31
KOG0179|consensus 235 99.17
KOG0180|consensus204 98.16
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 97.67
KOG0175|consensus 285 97.61
PRK05456172 ATP-dependent protease subunit HslV; Provisional 97.48
KOG0174|consensus224 97.46
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 97.08
KOG0177|consensus200 95.05
KOG0173|consensus 271 80.21
>KOG0178|consensus Back     alignment and domain information 
Probab=99.88  E-value=8.6e-23  Score=132.31  Aligned_cols=64  Identities=64%  Similarity=1.062  Sum_probs=62.2

Q ss_pred             CEEeecchHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhcCCCCCCCceeccc
Q psy3468           1 MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPFRRNKT   66 (68)
Q Consensus         1 ig~~~sGl~aD~r~lv~~~r~~a~~y~~~~~~~i~v~~la~~ls~~~q~~Tq~~~~R~~P~g~~~~   66 (68)
                      |.|+++|+++|+..|++.+|..|++|.+.|+++||++.|++.|+++.|.|||++|.|  |||||..
T Consensus        72 iaC~vaGlt~DAnvL~n~aRi~AQ~yl~~y~e~iP~eqLv~~lcdiKQayTQygG~R--PFGVSfL  135 (249)
T KOG0178|consen   72 IACAVAGLTSDANVLKNYARIIAQRYLFRYGEEIPCEQLVTFLCDIKQAYTQYGGKR--PFGVSFL  135 (249)
T ss_pred             eEEEEecccccHHHHHHHHHHHHHHHHHHhCCCCcHHHHHHHHHHHHHHHhhccCcC--CCceeee
Confidence            679999999999999999999999999999999999999999999999999999999  9999864

>KOG0181|consensus Back     alignment and domain information
>KOG0183|consensus Back     alignment and domain information
>KOG0182|consensus Back     alignment and domain information
>KOG0863|consensus Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>KOG0184|consensus Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>KOG0176|consensus Back     alignment and domain information
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>KOG0179|consensus Back     alignment and domain information
>KOG0180|consensus Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>KOG0175|consensus Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>KOG0174|consensus Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>KOG0177|consensus Back     alignment and domain information
>KOG0173|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
3unb_B 261 Mouse Constitutive 20s Proteasome In Complex With P 3e-23
1iru_C 261 Crystal Structure Of The Mammalian 20s Proteasome A 3e-23
1z7q_C 258 Crystal Structure Of The 20s Proteasome From Yeast 3e-11
3oeu_B 235 Structure Of Yeast 20s Open-Gate Proteasome With Co 3e-11
1vsy_C 232 Proteasome Activator Complex Length = 232 3e-11
1g0u_B 245 A Gated Channel Into The Proteasome Core Particle L 3e-11
1ryp_C 244 Crystal Structure Of The 20s Proteasome From Yeast 3e-11
3h4p_A 264 Proteasome 20s Core Particle From Methanocaldococcu 6e-08
1j2q_A 237 20s Proteasome In Complex With Calpain-inhibitor I 1e-07
1j2p_A 246 Alpha-Ring From The Proteasome From Archaeoglobus F 1e-06
1iru_B233 Crystal Structure Of The Mammalian 20s Proteasome A 2e-06
3unb_A234 Mouse Constitutive 20s Proteasome In Complex With P 2e-06
1fnt_D 254 Crystal Structure Of The 20s Proteasome From Yeast 4e-04
1vsy_D 227 Proteasome Activator Complex Length = 227 4e-04
1ryp_D 241 Crystal Structure Of The 20s Proteasome From Yeast 4e-04
1g0u_C 243 A Gated Channel Into The Proteasome Core Particle L 4e-04
>pdb|3UNB|B Chain B, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 261 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (256), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 48/61 (78%), Positives = 52/61 (85%), Gaps = 2/61 (3%)
Query: 1   MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIP 60
           M CSVAGITSDANVLT+ELR IAQRYL+QY EPIPCEQLV  LCDIKQ YTQ+GG+   P
Sbjct: 72  MACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKR--P 129
Query: 61  F 61
           F
Sbjct: 130 F 130
>pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 Back     alignment and structure
>pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|3OEU|B Chain B, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 235 Back     alignment and structure
>pdb|1VSY|C Chain C, Proteasome Activator Complex Length = 232 Back     alignment and structure
>pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 Back     alignment and structure
>pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 Back     alignment and structure
>pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 Back     alignment and structure
>pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 Back     alignment and structure
>pdb|1IRU|B Chain B, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 233 Back     alignment and structure
>pdb|3UNB|A Chain A, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 Back     alignment and structure
>pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 Back     alignment and structure
>pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 Back     alignment and structure
>pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
1iru_E241 20S proteasome; cell cycle, immune response, prote 2e-21
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 1e-20
1ryp_C 244 20S proteasome; multicatalytic proteinase, protein 2e-20
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 2e-20
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 3e-20
1ryp_E 242 20S proteasome; multicatalytic proteinase, protein 5e-20
1iru_A 246 20S proteasome; cell cycle, immune response, prote 6e-20
1ryp_D 241 20S proteasome; multicatalytic proteinase, protein 7e-20
1iru_C 261 20S proteasome; cell cycle, immune response, prote 8e-20
3nzj_F 288 Proteasome component C1; ubiquitin, protein degrad 9e-20
1j2p_A 246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 9e-20
1ryp_A 243 20S proteasome; multicatalytic proteinase, protein 9e-20
1iru_D 248 20S proteasome; cell cycle, immune response, prote 1e-19
1ryp_G 244 20S proteasome; multicatalytic proteinase, protein 1e-19
1iru_G 254 20S proteasome; cell cycle, immune response, prote 1e-19
1iru_B233 20S proteasome; cell cycle, immune response, prote 2e-19
1iru_F 263 20S proteasome; cell cycle, immune response, prote 2e-19
1ryp_B 250 20S proteasome; multicatalytic proteinase, protein 4e-18
3unf_H 234 Proteasome subunit beta type-10; antigen presentat 7e-14
1iru_I 234 20S proteasome; cell cycle, immune response, prote 2e-08
1q5q_A 259 Proteasome alpha-type subunit 1; proteasome assemb 5e-08
1ryp_I 222 20S proteasome; multicatalytic proteinase, protein 3e-07
3nzj_H 261 Proteasome component PUP1; ubiquitin, protein degr 7e-07
2jay_A 291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 4e-06
1q5q_H 235 Proteasome beta-type subunit 1; proteasome assembl 5e-06
1yar_H 217 Proteasome beta subunit; proteasome 20S, PA26 prot 8e-06
3mi0_A 248 Proteasome subunit alpha; enzyme inhibitors, lacto 8e-05
1iru_L204 20S proteasome; cell cycle, immune response, prote 8e-04
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 9e-04
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 Back     alignment and structure
 Score = 82.2 bits (204), Expect = 2e-21
 Identities = 12/62 (19%), Positives = 27/62 (43%)

Query: 1   MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIP 60
           + C+++G+ +DA  L  + R   Q +   YNE +  E +   + ++   + +        
Sbjct: 74  IGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAM 133

Query: 61  FR 62
            R
Sbjct: 134 SR 135
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
1ryp_A 243 20S proteasome; multicatalytic proteinase, protein 99.77
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 99.76
1iru_D 248 20S proteasome; cell cycle, immune response, prote 99.74
3nzj_F 288 Proteasome component C1; ubiquitin, protein degrad 99.74
1iru_F 263 20S proteasome; cell cycle, immune response, prote 99.74
1ryp_G 244 20S proteasome; multicatalytic proteinase, protein 99.73
1iru_G 254 20S proteasome; cell cycle, immune response, prote 99.73
1ryp_C 244 20S proteasome; multicatalytic proteinase, protein 99.73
1ryp_D 241 20S proteasome; multicatalytic proteinase, protein 99.73
1iru_A 246 20S proteasome; cell cycle, immune response, prote 99.72
1iru_B233 20S proteasome; cell cycle, immune response, prote 99.72
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 99.72
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 99.72
1j2p_A 246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 99.72
1iru_C 261 20S proteasome; cell cycle, immune response, prote 99.71
1ryp_E 242 20S proteasome; multicatalytic proteinase, protein 99.69
1iru_E241 20S proteasome; cell cycle, immune response, prote 99.67
1q5q_H 235 Proteasome beta-type subunit 1; proteasome assembl 99.65
1ryp_B 250 20S proteasome; multicatalytic proteinase, protein 99.63
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 99.63
3mi0_A 248 Proteasome subunit alpha; enzyme inhibitors, lacto 99.62
1q5r_H 294 Proteasome beta-type subunit 1; proteasome assembl 99.59
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 99.59
1iru_H 205 20S proteasome; cell cycle, immune response, prote 99.58
1yar_H 217 Proteasome beta subunit; proteasome 20S, PA26 prot 99.58
1iru_M 213 20S proteasome; cell cycle, immune response, prote 99.58
3h4p_a 219 Proteasome subunit beta; core particle, cytoplasm, 99.57
1iru_N 219 20S proteasome; cell cycle, immune response, prote 99.56
1ryp_L 212 20S proteasome; multicatalytic proteinase, protein 99.56
1q5q_A 259 Proteasome alpha-type subunit 1; proteasome assemb 99.55
1ryp_M 222 20S proteasome; multicatalytic proteinase, protein 99.55
1ryp_N 233 20S proteasome; multicatalytic proteinase, protein 99.54
3unf_N199 Proteasome subunit beta type-9; antigen presentati 99.54
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 99.53
1iru_L 204 20S proteasome; cell cycle, immune response, prote 99.52
1g0u_M 266 Proteasome component PRE4; ubiquitin, degradation, 99.51
2jay_A 291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 99.51
1iru_J205 20S proteasome; cell cycle, immune response, prote 99.49
1ryp_I 222 20S proteasome; multicatalytic proteinase, protein 99.48
3unf_H 234 Proteasome subunit beta type-10; antigen presentat 99.46
3nzj_K 287 Proteasome component PRE2; ubiquitin, protein degr 99.45
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 99.42
1iru_I 234 20S proteasome; cell cycle, immune response, prote 99.41
1iru_K201 20S proteasome; cell cycle, immune response, prote 99.39
3nzj_H 261 Proteasome component PUP1; ubiquitin, protein degr 99.34
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 99.11
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 99.1
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 98.98
3mav_A 395 Farnesyl pyrophosphate synthase; PV092040, structu 84.43
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
Probab=99.77  E-value=1.5e-18  Score=112.10  Aligned_cols=64  Identities=25%  Similarity=0.319  Sum_probs=62.1

Q ss_pred             CEEeecchHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhcCCCCCCCceeccc
Q psy3468           1 MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPFRRNKT   66 (68)
Q Consensus         1 ig~~~sGl~aD~r~lv~~~r~~a~~y~~~~~~~i~v~~la~~ls~~~q~~Tq~~~~R~~P~g~~~~   66 (68)
                      |+|++||+.+|++.|++++|.+|++|+++|+++||++.+|+.|++++|.|||+++.|  ||||+.+
T Consensus        70 i~~~~aG~~aD~~~l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~l~~y~~~~~~r--P~~v~~l  133 (243)
T 1ryp_A           70 IGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMR--PLGVILT  133 (243)
T ss_dssp             CEEEEESCHHHHHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHHHHBTTSC--CCSCEEE
T ss_pred             EEEEEEecHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHhccCCcc--ccceEEE
Confidence            689999999999999999999999999999999999999999999999999999999  9999875
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure
>3mav_A Farnesyl pyrophosphate synthase; PV092040, structural genomics, structural genomics consortium, SGC, transferase, isoprene biosynthesis; 2.10A {Plasmodium vivax} PDB: 3cc9_A* 3ez3_A* 3ldw_A* 3mys_A* 3ph7_A* 3rbm_A* 3ryw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 68
d1irue_234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 7e-09
d1irug_ 245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 2e-08
d1rypg_ 244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 3e-08
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 9e-08
d1rypf_233 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 4e-07
d1rypc_ 244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 2e-06
d1q5qa_ 227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 3e-06
d1irua_ 244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 3e-06
d1rype_ 242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 3e-06
d1rypa_ 243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 5e-06
d1irud_ 243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 7e-06
d1rypd_ 241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 9e-05
d1rypb_ 250 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 2e-04
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 47.3 bits (112), Expect = 7e-09
 Identities = 12/62 (19%), Positives = 27/62 (43%)

Query: 1   MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIP 60
           + C+++G+ +DA  L  + R   Q +   YNE +  E +   + ++   + +        
Sbjct: 67  IGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAM 126

Query: 61  FR 62
            R
Sbjct: 127 SR 128
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 99.78
d1irug_ 245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.76
d1irud_ 243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.76
d1irua_ 244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.72
d1iruf_ 238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.72
d1iruc_ 250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.71
d1rypg_ 244 Proteasome alpha subunit (non-catalytic) {Baker's 99.71
d1rypd_ 241 Proteasome alpha subunit (non-catalytic) {Baker's 99.7
d1rypa_ 243 Proteasome alpha subunit (non-catalytic) {Baker's 99.69
d1j2pa_ 243 Proteasome alpha subunit (non-catalytic) {Archaeon 99.68
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 99.65
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.65
d1rype_ 242 Proteasome alpha subunit (non-catalytic) {Baker's 99.6
d1rypb_ 250 Proteasome alpha subunit (non-catalytic) {Baker's 99.58
d1rypc_ 244 Proteasome alpha subunit (non-catalytic) {Baker's 99.58
d1q5qa_ 227 Proteasome alpha subunit (non-catalytic) {Rhodococ 99.52
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.51
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 99.47
d1yarh1 203 Proteasome beta subunit (catalytic) {Archaeon Ther 99.47
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 99.45
d1irul_201 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.39
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.38
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 99.33
d1iruh_ 202 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.32
d1rypl_ 212 Proteasome beta subunit (catalytic) {Baker's yeast 99.25
d1ryp2_ 233 Proteasome beta subunit (catalytic) {Baker's yeast 99.25
d1q5qh_ 224 Proteasome beta subunit (catalytic) {Rhodococcus e 99.22
d1iru2_ 217 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.15
d1irui_ 220 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.15
d1iru1_ 213 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.11
d1ryp1_ 222 Proteasome beta subunit (catalytic) {Baker's yeast 99.09
d1rypi_ 222 Proteasome beta subunit (catalytic) {Baker's yeast 99.07
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 99.04
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.03
d1l0oc_57 SigmaF {Bacillus stearothermophilus [TaxId: 1422]} 83.35
d1rp3a177 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 81.06
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.78  E-value=2.4e-19  Score=113.93  Aligned_cols=64  Identities=31%  Similarity=0.384  Sum_probs=62.2

Q ss_pred             CEEeecchHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhcCCCCCCCceeccc
Q psy3468           1 MVCSVAGITSDANVLTSELRAIAQRYLIQYNEPIPCEQLVACLCDIKQGYTQYGGQSIIPFRRNKT   66 (68)
Q Consensus         1 ig~~~sGl~aD~r~lv~~~r~~a~~y~~~~~~~i~v~~la~~ls~~~q~~Tq~~~~R~~P~g~~~~   66 (68)
                      |+|++||+.+|++.+++++|.+|++|+++|+++|+++.+|+.|++++|+|||+++.|  ||||+.+
T Consensus        69 i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~i~~~~la~~l~~~~~~~t~~~~~R--P~gv~~i  132 (233)
T d1rypf_          69 MGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGR--PYGVGLL  132 (233)
T ss_dssp             EEEEEEECHHHHHHHHHHHHHHHHHHHHHHSCCCCHHHHHHHHHHHHHHHHHBTTCC--CCCEEEE
T ss_pred             EEEEEeeccccHHHHHHHHHHHHHhhhhhcCCCCcHHHHHHHHHHHHHHHhcccccC--CccceEE
Confidence            589999999999999999999999999999999999999999999999999999999  9999875
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure