Diaphorina citri psyllid: psy3481


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340
MSDCEDTFMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM
cccccccccccccccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccCEEEEEcccccEEEcccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccCEECccccHHHHHHcHHHHHHcccccccccccHHHHHHHHccc
*******FMCDEEEDYGLEY*********VDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQT**G*DDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYD******RTTCLKYLVLANM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDCEDTFMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
COP9 signalosome complex subunit 2 Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.very confidentP61203
COP9 signalosome complex subunit 2 Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.very confidentP61202
COP9 signalosome complex subunit 2 Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.very confidentP61201

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045892 [BP]negative regulation of transcription, DNA-dependentconfidentGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0008180 [CC]signalosomeprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0010388 [BP]cullin deneddylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0000338, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0019538, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0030182 [BP]neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050821 [BP]protein stabilizationprobableGO:0019222, GO:0060255, GO:0010608, GO:0031647, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0035257 [MF]nuclear hormone receptor bindingprobableGO:0051427, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0007095 [BP]mitotic G2 DNA damage checkpointprobableGO:0010948, GO:0044773, GO:1901991, GO:1901990, GO:0050789, GO:0044699, GO:0051716, GO:0031572, GO:0031570, GO:0010564, GO:0065007, GO:0007049, GO:0048519, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0008150, GO:0044774, GO:1901988, GO:0000077, GO:0000075, GO:0051726, GO:0050896, GO:0044763, GO:0033554, GO:0022402, GO:0048523, GO:0007093
GO:0008231 [CC]repressor ecdysone receptor complexprobableGO:0031974, GO:0043229, GO:0008230, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0043235, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0035914 [BP]skeletal muscle cell differentiationprobableGO:0030154, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0007517, GO:0048869, GO:0007519, GO:0048513, GO:0032502, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0016922 [MF]ligand-dependent nuclear receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TXN, chain A
Confidence level:very confident
Coverage over the Query: 63-239,294-340
View the alignment between query and template
View the model in PyMOL
Template: 4B4T, chain P
Confidence level:confident
Coverage over the Query: 43-235,271-274,294-339
View the alignment between query and template
View the model in PyMOL
Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 155-295
View the alignment between query and template
View the model in PyMOL
Template: 4B4T, chain R
Confidence level:probable
Coverage over the Query: 46-181
View the alignment between query and template
View the model in PyMOL