Psyllid ID: psy3481

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340
MSDCEDTFMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM
cccccccccccccccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEEcccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccEEEEccccHHHHHHcHHHHHHcccccccccccHHHHHHHHccc
cccccHHcccccHHHccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHccccccHHHHHHHHccccccccccccEEEEEcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHccHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcc
msdcedtfmcdeeedygleysedsnsepdvdlenqyynskalkeddpkAALQSFQKVLdlesgergEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAkndrlwfktntklgklyfdreDFNKLSRILKQLHQscqtddgeddlkKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIksaiphplimGVIRGLFVIEAHEQNmeglrfkvplvpfvpglsiFFNIELMANLNVLTWLRFIIWMALECggkmhlregefeKAHTDFFEAFknydesgsprrttCLKYLVLANM
MSDCEDTFMCDEEEDYGLeysedsnsepdVDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALkdakndrlwfktntklgklyfDREDFNKLSRILKQLHqscqtddgeddLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIksaiphplIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAfknydesgsprrtTCLKYLVLANM
MSDCEDTFMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM
********************************************************VLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSC********LKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYD******RTTCLKYLVL***
****E*TFMCDEEEDYGLEY*********VDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQT**G*DDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGE***********************TTCLKYLVLANM
********MCDEEEDY***********PDVDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLH**********DLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM
*******FMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDCEDTFMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query340 2.2.26 [Sep-21-2011]
Q6IQT4 443 COP9 signalosome complex yes N/A 0.838 0.643 0.75 1e-140
P61203 443 COP9 signalosome complex yes N/A 0.838 0.643 0.747 1e-139
P61202 443 COP9 signalosome complex yes N/A 0.838 0.643 0.747 1e-139
P61201 443 COP9 signalosome complex yes N/A 0.838 0.643 0.747 1e-139
Q6IR75 441 COP9 signalosome complex N/A N/A 0.832 0.641 0.745 1e-138
Q94899 444 COP9 signalosome complex yes N/A 0.797 0.610 0.753 1e-135
O01422 495 COP9 signalosome complex yes N/A 0.791 0.543 0.600 1e-101
Q8W207 439 COP9 signalosome complex yes N/A 0.8 0.619 0.495 2e-82
Q54HL6 449 COP9 signalosome complex yes N/A 0.755 0.572 0.476 5e-78
Q5B3U7 506 COP9 signalosome complex yes N/A 0.835 0.561 0.421 3e-69
>sp|Q6IQT4|CSN2_DANRE COP9 signalosome complex subunit 2 OS=Danio rerio GN=cops2 PE=2 SV=1 Back     alignment and function desciption
 Score =  496 bits (1278), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 255/340 (75%), Positives = 272/340 (80%), Gaps = 55/340 (16%)

Query: 1   MSDCEDTFMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDL 60
           MSD ED FMCD+EEDY LEYSEDSNSEP+VDLENQYYNSKALKEDDPKAAL SFQKVL+L
Sbjct: 1   MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLEL 60

Query: 61  ESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYI 120
           E GE+GEWGFKALKQMIKINFKL+N+ EMM+RYKQLL YI+SAVTRNYSEKSINSILDYI
Sbjct: 61  E-GEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYI 119

Query: 121 STSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSC 180
           STSK M+LLQ+FYETTLEALKDAKNDRLWFKTNTKLGKLY +RE+F KL +IL+QLHQSC
Sbjct: 120 STSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEFGKLQKILRQLHQSC 179

Query: 181 QTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRG 240
           QTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLK LYEQSLHIKSAIPH         
Sbjct: 180 QTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPH--------- 230

Query: 241 LFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMH 300
                                P + G+                 +R       ECGGKMH
Sbjct: 231 ---------------------PLIMGV-----------------IR-------ECGGKMH 245

Query: 301 LREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM 340
           LREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM
Sbjct: 246 LREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM 285
Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity.
Danio rerio (taxid: 7955)
>sp|P61203|CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus GN=Cops2 PE=2 SV=1 Back     alignment and function description
>sp|P61202|CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus GN=Cops2 PE=1 SV=1 Back     alignment and function description
>sp|P61201|CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens GN=COPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q6IR75|CSN2_XENLA COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis GN=csn2 PE=2 SV=1 Back     alignment and function description
>sp|Q94899|CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster GN=alien PE=1 SV=2 Back     alignment and function description
>sp|O01422|CSN2_CAEEL COP9 signalosome complex subunit 2 OS=Caenorhabditis elegans GN=csn-2 PE=1 SV=2 Back     alignment and function description
>sp|Q8W207|CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana GN=CSN2 PE=1 SV=1 Back     alignment and function description
>sp|Q54HL6|CSN2_DICDI COP9 signalosome complex subunit 2 OS=Dictyostelium discoideum GN=csn2 PE=1 SV=1 Back     alignment and function description
>sp|Q5B3U7|CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnB PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query340
307170813 444 COP9 signalosome complex subunit 2 [Camp 0.841 0.644 0.782 1e-146
322788770 452 hypothetical protein SINV_00566 [Solenop 0.841 0.632 0.782 1e-146
383856485 444 PREDICTED: COP9 signalosome complex subu 0.841 0.644 0.785 1e-146
345485521 444 PREDICTED: COP9 signalosome complex subu 0.841 0.644 0.779 1e-145
307200707 444 COP9 signalosome complex subunit 2 [Harp 0.841 0.644 0.776 1e-145
380023534 444 PREDICTED: COP9 signalosome complex subu 0.841 0.644 0.773 1e-144
119597770 446 COP9 constitutive photomorphogenic homol 0.847 0.645 0.767 1e-144
383856487 453 PREDICTED: COP9 signalosome complex subu 0.841 0.631 0.765 1e-144
91075970 444 PREDICTED: similar to GA21877-PA [Tribol 0.841 0.644 0.761 1e-142
351715485 459 COP9 signalosome complex subunit 2 [Hete 0.864 0.640 0.749 1e-142
>gi|307170813|gb|EFN62929.1| COP9 signalosome complex subunit 2 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 266/340 (78%), Positives = 278/340 (81%), Gaps = 54/340 (15%)

Query: 1   MSDCEDTFMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDL 60
           MSD ED FMC+EEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDL
Sbjct: 1   MSDGEDDFMCEEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDL 60

Query: 61  ESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYI 120
           E GE+GEWGFKALKQMIKINFKLSNYKEMM+RYKQLL YIKSAVTRN+SEKSINSILDYI
Sbjct: 61  EGGEKGEWGFKALKQMIKINFKLSNYKEMMARYKQLLTYIKSAVTRNHSEKSINSILDYI 120

Query: 121 STSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSC 180
           STSKNMELLQDFYETTL+ALKDAKNDRLWFKTNTKLGKLY+DR DFNKL++ILKQLHQSC
Sbjct: 121 STSKNMELLQDFYETTLDALKDAKNDRLWFKTNTKLGKLYYDRSDFNKLAKILKQLHQSC 180

Query: 181 QTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRG 240
           QTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLK LYEQSLHIKSAIPH         
Sbjct: 181 QTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKTLYEQSLHIKSAIPH--------- 231

Query: 241 LFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMH 300
                                P + G+                 +R       ECGGKMH
Sbjct: 232 ---------------------PLIMGV-----------------IR-------ECGGKMH 246

Query: 301 LREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM 340
           LREGEFE+AHTDFFEAFKNYDESGSPRRTTCLKYLVLANM
Sbjct: 247 LREGEFERAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM 286

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322788770|gb|EFZ14338.1| hypothetical protein SINV_00566 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383856485|ref|XP_003703739.1| PREDICTED: COP9 signalosome complex subunit 2-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|345485521|ref|XP_003425288.1| PREDICTED: COP9 signalosome complex subunit 2-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307200707|gb|EFN80804.1| COP9 signalosome complex subunit 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380023534|ref|XP_003695573.1| PREDICTED: COP9 signalosome complex subunit 2-like [Apis florea] Back     alignment and taxonomy information
>gi|119597770|gb|EAW77364.1| COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis), isoform CRA_a [Homo sapiens] gi|431896015|gb|ELK05433.1| COP9 signalosome complex subunit 2 [Pteropus alecto] Back     alignment and taxonomy information
>gi|383856487|ref|XP_003703740.1| PREDICTED: COP9 signalosome complex subunit 2-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|91075970|ref|XP_969453.1| PREDICTED: similar to GA21877-PA [Tribolium castaneum] gi|270014618|gb|EFA11066.1| hypothetical protein TcasGA2_TC004662 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|351715485|gb|EHB18404.1| COP9 signalosome complex subunit 2 [Heterocephalus glaber] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query340
FB|FBgn0013746 444 alien "alien" [Drosophila mela 0.702 0.538 0.891 4e-138
ZFIN|ZDB-GENE-040625-15 443 cops2 "COP9 constitutive photo 0.7 0.537 0.891 2.2e-137
UNIPROTKB|E2REA8 443 COPS2 "Uncharacterized protein 0.7 0.537 0.887 4.5e-137
UNIPROTKB|P61201 443 COPS2 "COP9 signalosome comple 0.7 0.537 0.887 4.5e-137
MGI|MGI:1330276 443 Cops2 "COP9 (constitutive phot 0.7 0.537 0.887 4.5e-137
RGD|628791 443 Cops2 "COP9 signalosome subuni 0.7 0.537 0.887 4.5e-137
UNIPROTKB|P61203 443 Cops2 "COP9 signalosome comple 0.7 0.537 0.887 4.5e-137
UNIPROTKB|G3X736 450 COPS2 "Uncharacterized protein 0.7 0.528 0.861 7.5e-135
UNIPROTKB|F1SQG5385 COPS2 "Uncharacterized protein 0.676 0.597 0.891 6.7e-134
WB|WBGene00000814 495 csn-2 [Caenorhabditis elegans 0.682 0.468 0.680 2.4e-106
FB|FBgn0013746 alien "alien" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1115 (397.6 bits), Expect = 4.0e-138, Sum P(2) = 4.0e-138
 Identities = 213/239 (89%), Positives = 226/239 (94%)

Query:     1 MSDCEDTFMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDL 60
             MSD +D FMCD++EDYGLEYSEDSNSEPDVDLENQYYNSKALKE++PKAAL SFQKVLDL
Sbjct:     1 MSDNDDDFMCDDDEDYGLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDL 60

Query:    61 ESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYI 120
             E+GE+GEWGFKALKQMIKINF+L NY EMM RYKQLL YIKSAVTRN+SEKSINSILDYI
Sbjct:    61 ENGEKGEWGFKALKQMIKINFRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYI 120

Query:   121 STSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSC 180
             STSKNM LLQ+FYETTL+AL+DAKNDRLWFKTNTKLGKLYFDR DF KL +ILKQLHQSC
Sbjct:   121 STSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSC 180

Query:   181 QTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIR 239
             QTDDGEDDLKKGTQLLEIYALEIQMYT QKNNKKLK LYEQSLHIKSAIPHPLIMGVIR
Sbjct:   181 QTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIR 239
GO:0008231 "repressor ecdysone receptor complex" evidence=IPI
GO:0003714 "transcription corepressor activity" evidence=IDA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA
GO:0035257 "nuclear hormone receptor binding" evidence=IPI
GO:0016922 "ligand-dependent nuclear receptor binding" evidence=IPI
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0008180 "signalosome" evidence=NAS;IPI
GO:0007165 "signal transduction" evidence=ISS
GO:0004871 "signal transducer activity" evidence=ISS
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0050821 "protein stabilization" evidence=IMP
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
GO:0022008 "neurogenesis" evidence=IMP
ZFIN|ZDB-GENE-040625-15 cops2 "COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2REA8 COPS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61201 COPS2 "COP9 signalosome complex subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1330276 Cops2 "COP9 (constitutive photomorphogenic) homolog, subunit 2 (Arabidopsis thaliana)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|628791 Cops2 "COP9 signalosome subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P61203 Cops2 "COP9 signalosome complex subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3X736 COPS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQG5 COPS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00000814 csn-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O01422CSN2_CAEELNo assigned EC number0.60060.79110.5434yesN/A
Q6IR75CSN2_XENLANo assigned EC number0.74550.83230.6417N/AN/A
Q8W207CSN2_ARATHNo assigned EC number0.49540.80.6195yesN/A
Q94899CSN2_DROMENo assigned EC number0.75380.79700.6103yesN/A
P61203CSN2_RATNo assigned EC number0.74700.83820.6433yesN/A
P61202CSN2_MOUSENo assigned EC number0.74700.83820.6433yesN/A
Q6IQT4CSN2_DANRENo assigned EC number0.750.83820.6433yesN/A
Q9HFR0CSN2_SCHPONo assigned EC number0.39160.82050.6384yesN/A
P61201CSN2_HUMANNo assigned EC number0.74700.83820.6433yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
pfam1390651 pfam13906, AA_permease_C, C-terminus of AA_permeas 2e-17
TIGR00906557 TIGR00906, 2A0303, cationic amino acid transport p 3e-13
TIGR00909429 TIGR00909, 2A0306, amino acid transporter 7e-06
>gnl|CDD|206077 pfam13906, AA_permease_C, C-terminus of AA_permease Back     alignment and domain information 
 Score = 74.6 bits (184), Expect = 2e-17
 Identities = 23/38 (60%), Positives = 29/38 (76%)

Query: 256 FKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMAL 293
           FKVPLVPF+P LSI  NI LM  L+ LTW+RF +W+ +
Sbjct: 1   FKVPLVPFLPALSILINIYLMVQLDALTWIRFAVWLLI 38

This is the C-terminus of AA-permease enzymes that is not captured by the models pfam00324 and pfam13520. Length = 51
>gnl|CDD|129984 TIGR00906, 2A0303, cationic amino acid transport permease Back     alignment and domain information
>gnl|CDD|129987 TIGR00909, 2A0306, amino acid transporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 340
KOG1464|consensus 440 100.0
KOG1463|consensus 411 100.0
COG5159 421 RPN6 26S proteasome regulatory complex component [ 99.94
TIGR00906557 2A0303 cationic amino acid transport permease. 99.79
PF1390651 AA_permease_C: C-terminus of AA_permease 99.59
TIGR00909429 2A0306 amino acid transporter. 99.24
PRK11357445 frlA putative fructoselysine transporter; Provisio 99.21
TIGR00908442 2A0305 ethanolamine permease. The three genes used 99.13
PRK10655438 potE putrescine transporter; Provisional 98.93
TIGR00911501 2A0308 L-type amino acid transporter. 98.78
PRK10644445 arginine:agmatin antiporter; Provisional 98.78
PRK11387471 S-methylmethionine transporter; Provisional 98.73
PRK10836489 lysine transporter; Provisional 98.72
TIGR00905473 2A0302 transporter, basic amino acid/polyamine ant 98.71
PRK10580457 proY putative proline-specific permease; Provision 98.65
PRK11049469 D-alanine/D-serine/glycine permease; Provisional 98.58
TIGR00930 953 2a30 K-Cl cotransporter. 98.52
PRK10197446 gamma-aminobutyrate transporter; Provisional 98.49
TIGR00913478 2A0310 amino acid permease (yeast). 98.48
PRK15049499 L-asparagine permease; Provisional 98.44
TIGR03813474 put_Glu_GABA_T putative glutamate/gamma-aminobutyr 98.42
PRK10746461 putative transport protein YifK; Provisional 98.4
PRK10249458 phenylalanine transporter; Provisional 98.32
PRK11021410 putative transporter; Provisional 98.31
TIGR00910507 2A0307_GadC glutamate:gamma-aminobutyrate antiport 98.28
TIGR03810468 arg_ornith_anti arginine/ornithine antiporter. Mem 98.27
TIGR00907482 2A0304 amino acid permease (GABA permease). 98.25
TIGR01773452 GABAperm gamma-aminobutyrate permease. GabP is hig 98.24
PRK10435435 cadB lysine/cadaverine antiporter; Provisional 98.23
PRK10238456 aromatic amino acid transporter; Provisional 98.16
COG0531466 PotE Amino acid transporters [Amino acid transport 98.06
KOG1286|consensus554 97.96
KOG1287|consensus479 97.89
PF00324478 AA_permease: Amino acid permease; InterPro: IPR004 97.64
TIGR03428475 ureacarb_perm permease, urea carboxylase system. A 97.37
COG1113462 AnsP Gamma-aminobutyrate permease and related perm 97.35
PRK15238496 inner membrane transporter YjeM; Provisional 97.34
PF13520426 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3G 97.2
COG0833541 LysP Amino acid transporters [Amino acid transport 96.95
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.16
KOG1840|consensus508 95.86
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 95.2
PRK11788389 tetratricopeptide repeat protein; Provisional 94.73
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 94.28
PRK11788389 tetratricopeptide repeat protein; Provisional 94.19
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 93.41
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 93.36
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 92.06
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 91.65
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 91.63
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 90.71
KOG1840|consensus508 90.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 90.15
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.81
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 89.25
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 89.08
TIGR00837381 araaP aromatic amino acid transport protein. aroma 88.99
PRK10803263 tol-pal system protein YbgF; Provisional 88.37
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 87.71
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 87.53
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 87.31
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 86.91
PLN03218 1060 maturation of RBCL 1; Provisional 86.8
PF03704146 BTAD: Bacterial transcriptional activator domain; 86.3
PRK10803263 tol-pal system protein YbgF; Provisional 86.21
PF05297 381 Herpes_LMP1: Herpesvirus latent membrane protein 1 86.08
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 85.4
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 84.81
PLN03218 1060 maturation of RBCL 1; Provisional 84.46
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 84.27
COG4105254 ComL DNA uptake lipoprotein [General function pred 83.85
PF04147 840 Nop14: Nop14-like family ; InterPro: IPR007276 Emg 83.51
PF13512142 TPR_18: Tetratricopeptide repeat 82.84
cd00189100 TPR Tetratricopeptide repeat domain; typically con 82.62
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 82.62
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 82.56
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 81.29
PF1337173 TPR_9: Tetratricopeptide repeat 81.08
PRK10747398 putative protoheme IX biogenesis protein; Provisio 81.0
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 80.24
>KOG1464|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.9e-91  Score=658.99  Aligned_cols=279  Identities=89%  Similarity=1.360  Sum_probs=272.5

Q ss_pred             cccccccccccccccCCCCCCCccchhhhhhccccccccCCHHHHHHHHHhhcccccccchhhHHHHHHHHHHHHhhhcC
Q psy3481           6 DTFMCDEEEDYGLEYSEDSNSEPDVDLENQYYNSKALKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSN   85 (340)
Q Consensus         6 d~~~~d~~e~y~~~~~~~~~~~~~~~lEn~y~~ak~~~~~~~~~a~~~~~~v~~~~~~~~~~w~fka~~q~~k~~~~~~~   85 (340)
                      |||| ||||||||||+||+++||||||||||||+|++++++|++|+.+|++|++++ +|+|+||||||||||||+|++++
T Consensus         3 D~~M-dddEDYg~EYsdds~sEpdVDlENQYYnsK~l~e~~p~~Al~sF~kVlelE-gEKgeWGFKALKQmiKI~f~l~~   80 (440)
T KOG1464|consen    3 DDFM-DDDEDYGFEYSDDSNSEPDVDLENQYYNSKGLKEDEPKEALSSFQKVLELE-GEKGEWGFKALKQMIKINFRLGN   80 (440)
T ss_pred             cccc-ccchhcCceeccccCCCCCcchHhhhhccccccccCHHHHHHHHHHHHhcc-cccchhHHHHHHHHHHHHhcccc
Confidence            4788 456999999999999999999999999999999999999999999999999 99999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhhccchhhHHHHHHHHHHHhhcCCChhHHHHHHHHHHHHHhhccchhhhHhHHhHHHHhhhcccc
Q psy3481          86 YKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDRED  165 (340)
Q Consensus        86 ~~~~~~~~~~l~~~~~~~v~k~~~~k~i~~ild~~~~~~~~~~~~~~~~~~~~~~~~~~~~rlf~k~n~kL~~l~~~m~~  165 (340)
                      |++||++|+|+++||+|+|||||+||+||+|+||+|+|++++++|.||++|+++|++|+|+||||||||||+++||+.++
T Consensus        81 ~~eMm~~Y~qlLTYIkSAVTrNySEKsIN~IlDyiStS~~m~LLQ~FYeTTL~ALkdAKNeRLWFKTNtKLgkl~fd~~e  160 (440)
T KOG1464|consen   81 YKEMMERYKQLLTYIKSAVTRNYSEKSINSILDYISTSKNMDLLQEFYETTLDALKDAKNERLWFKTNTKLGKLYFDRGE  160 (440)
T ss_pred             HHHHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHhhhcceeeeeccchHhhhheeHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHhhcCCCCCccccccccchhHHHHHHHHHHHhhhchHHHHHHHHhhhhhhhhhhHHHHHHHHHHHhhhe
Q psy3481         166 FNKLSRILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAIPHPLIMGVIRGLFVIE  245 (340)
Q Consensus       166 ~~~lp~~l~~lH~~~ktp~~a~~~~~~~llleV~aleI~~~~~l~n~~~l~~~~~~~~~i~~si~~~~~~~vv~~~lIil  245 (340)
                      ++.+.+++.++|..|+|.++.+|+++|++|+||+++|||||+.++|+++++++|.++..+.++++||++++++.      
T Consensus       161 ~~kl~KIlkqLh~SCq~edGedD~kKGtQLLEiYAlEIQmYT~qKnNKkLK~lYeqalhiKSAIPHPlImGvIR------  234 (440)
T KOG1464|consen  161 YTKLQKILKQLHQSCQTEDGEDDQKKGTQLLEIYALEIQMYTEQKNNKKLKALYEQALHIKSAIPHPLIMGVIR------  234 (440)
T ss_pred             HHHHHHHHHHHHHHhccccCchhhhccchhhhhHhhHhhhhhhhcccHHHHHHHHHHHHhhccCCchHHHhHHH------
Confidence            99999999999999999999999999999999999999999999999999999999999999999999997765      


Q ss_pred             ecccCCCCCcccccccchhhHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhhhhhcccccccccchhHHHhhhccCCCCC
Q psy3481         246 AHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGKMHLREGEFEKAHTDFFEAFKNYDESGS  325 (340)
Q Consensus       246 R~~~p~~~r~FrvPlvP~iP~l~il~~l~L~~~L~~~tw~~~~vW~~iG~YG~rhS~~~~~~~~~~~F~eaF~~yde~g~  325 (340)
                                                                      -|.|..|-+.|++..+|++||||||||||+|+
T Consensus       235 ------------------------------------------------ECGGKMHlreg~fe~AhTDFFEAFKNYDEsGs  266 (440)
T KOG1464|consen  235 ------------------------------------------------ECGGKMHLREGEFEKAHTDFFEAFKNYDESGS  266 (440)
T ss_pred             ------------------------------------------------HcCCccccccchHHHHHhHHHHHHhcccccCC
Confidence                                                            46899999999999999999999999999999


Q ss_pred             cchHHHHHHHHHhcC
Q psy3481         326 PRRTTCLKYLVLANM  340 (340)
Q Consensus       326 ~~~~~~LKYl~L~~~  340 (340)
                      |||++||||||||||
T Consensus       267 pRRttCLKYLVLANM  281 (440)
T KOG1464|consen  267 PRRTTCLKYLVLANM  281 (440)
T ss_pred             cchhHHHHHHHHHHH
Confidence            999999999999998

>KOG1463|consensus Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00906 2A0303 cationic amino acid transport permease Back     alignment and domain information
>PF13906 AA_permease_C: C-terminus of AA_permease Back     alignment and domain information
>TIGR00909 2A0306 amino acid transporter Back     alignment and domain information
>PRK11357 frlA putative fructoselysine transporter; Provisional Back     alignment and domain information
>TIGR00908 2A0305 ethanolamine permease Back     alignment and domain information
>PRK10655 potE putrescine transporter; Provisional Back     alignment and domain information
>TIGR00911 2A0308 L-type amino acid transporter Back     alignment and domain information
>PRK10644 arginine:agmatin antiporter; Provisional Back     alignment and domain information
>PRK11387 S-methylmethionine transporter; Provisional Back     alignment and domain information
>PRK10836 lysine transporter; Provisional Back     alignment and domain information
>TIGR00905 2A0302 transporter, basic amino acid/polyamine antiporter (APA) family Back     alignment and domain information
>PRK10580 proY putative proline-specific permease; Provisional Back     alignment and domain information
>PRK11049 D-alanine/D-serine/glycine permease; Provisional Back     alignment and domain information
>TIGR00930 2a30 K-Cl cotransporter Back     alignment and domain information
>PRK10197 gamma-aminobutyrate transporter; Provisional Back     alignment and domain information
>TIGR00913 2A0310 amino acid permease (yeast) Back     alignment and domain information
>PRK15049 L-asparagine permease; Provisional Back     alignment and domain information
>TIGR03813 put_Glu_GABA_T putative glutamate/gamma-aminobutyrate antiporter Back     alignment and domain information
>PRK10746 putative transport protein YifK; Provisional Back     alignment and domain information
>PRK10249 phenylalanine transporter; Provisional Back     alignment and domain information
>PRK11021 putative transporter; Provisional Back     alignment and domain information
>TIGR00910 2A0307_GadC glutamate:gamma-aminobutyrate antiporter Back     alignment and domain information
>TIGR03810 arg_ornith_anti arginine/ornithine antiporter Back     alignment and domain information
>TIGR00907 2A0304 amino acid permease (GABA permease) Back     alignment and domain information
>TIGR01773 GABAperm gamma-aminobutyrate permease Back     alignment and domain information
>PRK10435 cadB lysine/cadaverine antiporter; Provisional Back     alignment and domain information
>PRK10238 aromatic amino acid transporter; Provisional Back     alignment and domain information
>COG0531 PotE Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1286|consensus Back     alignment and domain information
>KOG1287|consensus Back     alignment and domain information
>PF00324 AA_permease: Amino acid permease; InterPro: IPR004841 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>TIGR03428 ureacarb_perm permease, urea carboxylase system Back     alignment and domain information
>COG1113 AnsP Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15238 inner membrane transporter YjeM; Provisional Back     alignment and domain information
>PF13520 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3GI8_C 3GIA_A 3GI9_C 3OB6_A 3L1L_A 3LRC_D 3LRB_B 4DJK_A 4DJI_A Back     alignment and domain information
>COG0833 LysP Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00837 araaP aromatic amino acid transport protein Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF05297 Herpes_LMP1: Herpesvirus latent membrane protein 1 (LMP1); InterPro: IPR007961 This family consists of several latent membrane protein 1 or LMP1s mostly from Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04147 Nop14: Nop14-like family ; InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 8e-46
3gia_A444 Uncharacterized protein MJ0609; membrane protein, 6e-10
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 4e-07
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
3l1l_A445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 3e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 8e-04
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
 Score =  159 bits (403), Expect = 8e-46
 Identities = 53/289 (18%), Positives = 97/289 (33%), Gaps = 64/289 (22%)

Query: 57  VLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIK---SAVTRNYSEKSI 113
           V D E  E  E   +  +Q I    +L   +        L+   +   S++++  + K +
Sbjct: 2   VRDQEGAENDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLV 61

Query: 114 NSILDYIST-SKNMELLQDFYETTLEALKDAKNDRLWFKTNTKLGKLYFDREDFNKLSRI 172
            S++D          +     +  +E  K  K   L      +L  LYFD   + +   +
Sbjct: 62  RSLVDMFLDMDAGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALAL 121

Query: 173 LKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLYEQSLHIKSAI-PH 231
             QL +  +  D ++       L+E+  LE + Y A  N  K +     +    +AI   
Sbjct: 122 GAQLLRELKKLDDKN------LLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCP 175

Query: 232 PLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWM 291
           P + G +                                                     
Sbjct: 176 PKVQGALD---------------------------------------------------- 183

Query: 292 ALECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM 340
            L+ G      E +F+ A + F+EAF+ +D   S +  T LKY++L  +
Sbjct: 184 -LQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKI 231
>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Length = 444 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Length = 445 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 100.0
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 99.82
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.78
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 99.35
3l1l_A445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 98.69
4djk_A511 Probable glutamate/gamma-aminobutyrate antiporter; 98.22
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.72
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.62
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.55
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.53
3gia_A444 Uncharacterized protein MJ0609; membrane protein, 97.5
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.46
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.33
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.3
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.16
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.15
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.14
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.1
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.87
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 96.84
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.75
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.75
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.73
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 96.65
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.65
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.63
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.44
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 96.41
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.4
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.4
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.39
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 96.2
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.15
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 95.65
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 95.53
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 95.5
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.45
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 94.88
4b4t_O 393 26S proteasome regulatory subunit RPN9; hydrolase, 94.8
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 94.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 94.65
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 94.53
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 94.47
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 94.46
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 94.19
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 94.03
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 94.02
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 93.99
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 93.96
3u4t_A272 TPR repeat-containing protein; structural genomics 93.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 93.93
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 93.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 93.9
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 93.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 93.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 93.77
4i17_A228 Hypothetical protein; TPR repeats protein, structu 93.75
3u4t_A272 TPR repeat-containing protein; structural genomics 93.7
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 93.65
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 93.58
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 93.55
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 93.53
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 93.52
4eqf_A365 PEX5-related protein; accessory protein, tetratric 93.51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 93.43
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 93.4
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 93.3
4i17_A228 Hypothetical protein; TPR repeats protein, structu 93.26
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 93.24
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 93.15
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 93.07
3t5v_B 455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 93.06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 93.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 92.95
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 92.89
4eqf_A365 PEX5-related protein; accessory protein, tetratric 92.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 92.74
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 92.68
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 92.62
2gw1_A514 Mitochondrial precursor proteins import receptor; 92.57
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 92.51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 92.43
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 92.32
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 92.27
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 92.06
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 91.97
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 91.81
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 91.78
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 91.53
2kat_A115 Uncharacterized protein; NESG, structure, structur 91.39
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 91.35
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 91.31
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 91.3
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.26
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 91.22
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 91.12
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 90.98
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 90.68
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 90.68
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 90.57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 90.53
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 90.29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 90.26
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 89.58
2gw1_A514 Mitochondrial precursor proteins import receptor; 89.29
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 89.03
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 88.77
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 88.57
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 88.36
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 88.19
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 88.09
2l6j_A111 TPR repeat-containing protein associated with HSP; 87.85
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 87.29
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 87.19
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 86.92
3qww_A433 SET and MYND domain-containing protein 2; methyltr 86.83
3k9i_A117 BH0479 protein; putative protein binding protein, 86.73
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 86.72
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 86.65
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 86.6
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 86.59
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 86.41
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 86.32
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 86.12
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 86.05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 85.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 85.97
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 85.89
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 85.72
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 85.46
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 85.2
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 85.2
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 84.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 84.35
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 83.87
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 83.81
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 83.62
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 83.48
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 83.3
3q49_B137 STIP1 homology and U box-containing protein 1; E3 83.14
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 83.09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 82.99
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 82.91
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 82.87
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 82.84
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 82.5
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 82.13
3qww_A433 SET and MYND domain-containing protein 2; methyltr 82.1
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 81.58
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 81.43
3k9i_A117 BH0479 protein; putative protein binding protein, 80.51
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 80.2
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 80.06
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
Probab=100.00  E-value=1.1e-36  Score=302.14  Aligned_cols=215  Identities=23%  Similarity=0.308  Sum_probs=196.7

Q ss_pred             ccchhhHHHHHHHHHHHHhhhcCHHHHHHHHHHHHHHhhhccchhhHHHHHHHHHHHhhcCCChhHHHHHHHHHHHHHhh
Q psy3481          63 GERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYISTSKNMELLQDFYETTLEALKD  142 (340)
Q Consensus        63 ~~~~~w~fka~~q~~k~~~~~~~~~~~~~~~~~l~~~~~~~v~k~~~~k~i~~ild~~~~~~~~~~~~~~~~~~~~~~~~  142 (340)
                      ++..+.+++|+-+++++|+++|+++++.+++++++||+ +.++|||++|+||+|+|.++.++++.  +.+|++|++||+|
T Consensus        12 ~~~~~~~e~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~kak~~k~v~~l~~~~~~~~~~~--~~~~~~~~~~~~~   88 (394)
T 3txn_A           12 EERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFL-SSISKAKAAKLVRSLVDMFLDMDAGT--GIEVQLCKDCIEW   88 (394)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHTTTGG-GGSCHHHHHHHHHHHHHHHTTSCCCH--HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHH-HHhchHHHHHHHHHHHHHHhcCCCcH--HHHHHHHHHHHHH
Confidence            35578899999999999999999999999999999999 89999999999999999999999876  4589999999999


Q ss_pred             ccc-hhhhHh--HHhHHHHhhhcccchHHHHHHHHHHHhhcCCCCCccccccccchhHHHHHHHHHHHhhhchHHHHHHH
Q psy3481         143 AKN-DRLWFK--TNTKLGKLYFDREDFNKLSRILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKKLY  219 (340)
Q Consensus       143 ~~~-~rlf~k--~n~kL~~l~~~m~~~~~lp~~l~~lH~~~ktp~~a~~~~~~~llleV~aleI~~~~~l~n~~~l~~~~  219 (340)
                      |++ +|+|+|  +|+||+.+|+++++++.+++++.++|.+|++.+   +   +++++||+++||++|+.++|+++++.++
T Consensus        89 a~~~~r~flr~~l~~kL~~l~~~~~~y~~a~~~i~~l~~~~~~~d---d---~~~llev~lle~~~~~~~~n~~k~k~~l  162 (394)
T 3txn_A           89 AKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKLD---D---KNLLVEVQLLESKTYHALSNLPKARAAL  162 (394)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTSS---C---THHHHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHhccc---c---chhHHHHHHHHHHHHHHhccHHHHHHHH
Confidence            987 699999  456999999999999999999999999999876   3   8999999999999999999999999999


Q ss_pred             Hhhhhhhhhh-hHHHHHHHHHHHhhheecccCCCCCcccccccchhhHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhhh
Q psy3481         220 EQSLHIKSAI-PHPLIMGVIRGLFVIEAHEQNMEGLRFKVPLVPFVPGLSIFFNIELMANLNVLTWLRFIIWMALECGGK  298 (340)
Q Consensus       220 ~~~~~i~~si-~~~~~~~vv~~~lIilR~~~p~~~r~FrvPlvP~iP~l~il~~l~L~~~L~~~tw~~~~vW~~iG~YG~  298 (340)
                      +.+.++++++ .+|.+...+-                                                      -+.|.
T Consensus       163 ~~a~~~~~ai~~~p~i~a~i~------------------------------------------------------~~~Gi  188 (394)
T 3txn_A          163 TSARTTANAIYCPPKVQGALD------------------------------------------------------LQSGI  188 (394)
T ss_dssp             HHHHHHHHHSCCCHHHHHHHH------------------------------------------------------HHHHH
T ss_pred             HHHHhhhccCCCCHHHHHHHH------------------------------------------------------HHhhH
Confidence            9999999887 5555543322                                                      13699


Q ss_pred             hhc-ccccccccchhHHHhhhccCCCCCcchHHHHHHHHHhcC
Q psy3481         299 MHL-REGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANM  340 (340)
Q Consensus       299 rhS-~~~~~~~~~~~F~eaF~~yde~g~~~~~~~LKYl~L~~~  340 (340)
                      .|. ..+.+++|.++|+|||++|+++|+|++++|||||+||+|
T Consensus       189 ~~l~~~rdyk~A~~~F~eaf~~f~~~~~~~~~~~lkYlvL~aL  231 (394)
T 3txn_A          189 LHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKI  231 (394)
T ss_dssp             HHHHTTSCHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHhccCHHHHHHHHHHHHhcccccccHHHHHHHHHHHHHHH
Confidence            999 899999999999999999999999999999999999975
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Back     alignment and structure
>4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.52
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.29
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.0
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 92.7
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 92.65
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 92.39
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 92.39
d1hz4a_366 Transcription factor MalT domain III {Escherichia 92.15
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 91.85
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 91.74
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 91.73
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 91.63
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 91.43
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 91.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 90.17
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 89.94
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 88.93
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 88.9
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 88.8
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 87.91
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 87.56
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 87.51
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 86.98
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 86.82
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 83.9
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 83.77
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 83.72
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 83.63
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 83.5
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 83.38
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 83.31
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 83.24
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 82.93
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 82.65
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 80.32
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]

Probab=97.52  E-value=0.013  Score=49.20  Aligned_cols=142  Identities=6%  Similarity=-0.038  Sum_probs=95.0

Q ss_pred             cccCCHHHHHHHHHhhcccccccchhhHHHHHHHHHHHHhhhcCHHHHHHHHHHHHHHhhhccchhhHHHHHHHHHHHhh
Q psy3481          42 LKEDDPKAALQSFQKVLDLESGERGEWGFKALKQMIKINFKLSNYKEMMSRYKQLLLYIKSAVTRNYSEKSINSILDYIS  121 (340)
Q Consensus        42 ~~~~~~~~a~~~~~~v~~~~~~~~~~w~fka~~q~~k~~~~~~~~~~~~~~~~~l~~~~~~~v~k~~~~k~i~~ild~~~  121 (340)
                      +...++++|++.|++.++..++........++..+..+++.+|++++.++.|++.+......-.......+...+-....
T Consensus        23 ~~~g~~~~A~~~~~~aL~~~~~~~~~~~~~a~~~lg~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~  102 (366)
T d1hz4a_          23 INDGNPDEAERLAKLALEELPPGWFYSRIVATSVLGEVLHCKGELTRSLALMQQTEQMARQHDVWHYALWSLIQQSEILF  102 (366)
T ss_dssp             HHTTCHHHHHHHHHHHHHTCCTTCHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHH
T ss_pred             HHCCCHHHHHHHHHHHHhhCcCCCcHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHH
Confidence            45778999999999999876433445567789999999999999999999999998865332222223333333333333


Q ss_pred             cCCChhHHHHHHHHHHHHHhhccc--hhhhHhHHhHHHHhhhcccchHHHHHHHHHHHhhcCCC
Q psy3481         122 TSKNMELLQDFYETTLEALKDAKN--DRLWFKTNTKLGKLYFDREDFNKLSRILKQLHQSCQTD  183 (340)
Q Consensus       122 ~~~~~~~~~~~~~~~~~~~~~~~~--~rlf~k~n~kL~~l~~~m~~~~~lp~~l~~lH~~~ktp  183 (340)
                      ...+.......+...++.......  ..........++.+++.+++.......+.+........
T Consensus       103 ~~~~~~~a~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~a~~~~~~~~~~~~~~  166 (366)
T d1hz4a_         103 AQGFLQTAWETQEKAFQLINEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVLSSY  166 (366)
T ss_dssp             HTTCHHHHHHHHHHHHHHHHHTTCTTSTHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTTTS
T ss_pred             HHHHHHHHHHHHHHHHHHhHhcccchhhHHHHHHHHHHHHHHHhcchhhhHHHHHHHHHHhhhh
Confidence            333333333444444443333222  22333456778999999999999999999888876543
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure