Diaphorina citri psyllid: psy3490

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MLHLNPVTSEIVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHHLC
cccccccccEEEEEEccccccccEEEEEcccccccccEEEEEEccccHHHHHcccccccEEEEEccEEcccccHHHHHHHHHHccccc
******VTSEIVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHH**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLHLNPVTSEIVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVGLPLSTCQTYIKVNHHLC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Amyloid beta A4 precursor protein-binding family A member 1 Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.confidentQ02410
Amyloid beta A4 precursor protein-binding family A member 1 Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-AAP.confidentO35430
Amyloid beta A4 precursor protein-binding family A member 1 Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-AAP.confidentB2RUJ5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneconfidentGO:0005575
GO:0005546 [MF]phosphatidylinositol-4,5-bisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0001540 [MF]beta-amyloid bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0005488
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0050839 [MF]cell adhesion molecule bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0007626 [BP]locomotory behaviorprobableGO:0044708, GO:0050896, GO:0008150, GO:0007610
GO:0016079 [BP]synaptic vesicle exocytosisprobableGO:0019226, GO:0003001, GO:0035637, GO:0051648, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0051640, GO:0097479, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0007269, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0008150, GO:0006836
GO:0006461 [BP]protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0008105 [BP]asymmetric protein localizationprobableGO:0033036, GO:0008104, GO:0008150, GO:0051179
GO:0008088 [BP]axon cargo transportprobableGO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0006928, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0030705, GO:0051179, GO:0044699, GO:0051641
GO:0043086 [BP]negative regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0050789
GO:0030140 [CC]trans-Golgi network transport vesicleprobableGO:0030135, GO:0043229, GO:0030133, GO:0043227, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0031982, GO:0016023, GO:0031410, GO:0031988, GO:0044431, GO:0005794, GO:0005798, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0004857 [MF]enzyme inhibitor activityprobableGO:0030234, GO:0003674
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0014051 [BP]gamma-aminobutyric acid secretionprobableGO:0015812, GO:0006865, GO:0046717, GO:0006820, GO:0023052, GO:0044699, GO:0071705, GO:0071702, GO:0006810, GO:0015718, GO:0015849, GO:0006811, GO:0009987, GO:0015711, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0046942, GO:0044700, GO:0046903, GO:0008150
GO:0030165 [MF]PDZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0035264 [BP]multicellular organism growthprobableGO:0044699, GO:0032501, GO:0008150, GO:0040007, GO:0044707
GO:0048749 [BP]compound eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000138 [CC]Golgi trans cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0014047 [BP]glutamate secretionprobableGO:0006865, GO:0006820, GO:0023052, GO:0008150, GO:0044699, GO:0071705, GO:0071702, GO:0046942, GO:0009987, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0032940, GO:0006835
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SUZ, chain A
Confidence level:very confident
Coverage over the Query: 3-84
View the alignment between query and template
View the model in PyMOL