Diaphorina citri psyllid: psy3492


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MPRLQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQDAQT
ccccHHHHHcHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccc
***LQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQ****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRLQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQDAQT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein charlatan Probable transcription factor involved in the development of the adult pattern of macrochaetae. Required for accumulation of achaete (ac) and scute (sc) in proneural clusters. Probably acts by binding to the proneural cluster-specific enhancers of the ac/sc complex and increasing enhancer efficiency, thereby acting as a stimulator of ac/sc expression in proneural clusters. Also required for correct development of the embryonic/larval peripheral nervous system (PNS).confidentQ7YU81

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0001078 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044427 [CC]chromosomal partprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007458 [BP]progression of morphogenetic furrow involved in compound eye morphogenesisprobableGO:0032502, GO:0048749, GO:0009887, GO:0009653, GO:0044707, GO:0007423, GO:0032501, GO:0048592, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0001745, GO:0007275, GO:0044699
GO:0048863 [BP]stem cell differentiationprobableGO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0009968 [BP]negative regulation of signal transductionprobableGO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0042683 [BP]negative regulation of compound eye cone cell fate specificationprobableGO:0051093, GO:0009996, GO:0022603, GO:0050793, GO:0010453, GO:0010454, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0042659, GO:2000027, GO:0051239, GO:0048519, GO:0042682, GO:2000026, GO:0050789, GO:0048523
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0001700 [BP]embryonic development via the syncytial blastodermprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007422 [BP]peripheral nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044451 [CC]nucleoplasm partprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DLQ, chain A
Confidence level:confident
Coverage over the Query: 1-82
View the alignment between query and template
View the model in PyMOL