Psyllid ID: psy3492


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MPRLQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQDAQT
ccccHHHHHcHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccc
ccccEEEEEcHHHHHHHHcccccccEccccccHHHHHHHHHHHHHHHccHHHcccccccHccHHHHHHHHHccEEEEEccccccc
MPRLQVLISYNWCLKRHlnthikpfncALCEYKAARPERLATHVIKVHNkricskcsflADDQETLNEHLQQHIFWEcsfqdaqt
MPRLQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQDAQT
MPRLQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQDAQT
***LQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSF*****
****QVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQ****
MPRLQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQDAQT
*PRLQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQ****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRLQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHLQQHIFWECSFQDAQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query85 2.2.26 [Sep-21-2011]
Q7YU81 1214 Protein charlatan OS=Dros yes N/A 0.694 0.048 0.745 3e-21
Q2EI21 1501 RE1-silencing transcripti N/A N/A 0.717 0.040 0.318 0.0002
Q61164 736 Transcriptional repressor yes N/A 0.694 0.080 0.327 0.0003
Q96JM2 2506 Zinc finger protein 462 O yes N/A 0.658 0.022 0.419 0.0005
Q8VIG1 1082 RE1-silencing transcripti no N/A 0.717 0.056 0.318 0.0005
Q13127 1097 RE1-silencing transcripti no N/A 0.717 0.055 0.318 0.0007
O54963 1069 RE1-silencing transcripti no N/A 0.717 0.057 0.318 0.0008
Q01611 794 Zinc finger Y-chromosomal N/A N/A 0.705 0.075 0.369 0.0008
>sp|Q7YU81|CHN_DROME Protein charlatan OS=Drosophila melanogaster GN=chn PE=2 SV=3 Back     alignment and function desciption
 Score =  100 bits (249), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/59 (74%), Positives = 48/59 (81%)

Query: 12  WCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHL 70
           W LKRHLNTH KPF C LC+YKAAR ERLATHV+KVHNKR CSKCS+LAD QE    H+
Sbjct: 509 WGLKRHLNTHTKPFVCLLCDYKAARSERLATHVLKVHNKRACSKCSYLADTQEEYQAHM 567




Probable transcription factor involved in the development of the adult pattern of macrochaetae. Required for accumulation of achaete (ac) and scute (sc) in proneural clusters. Probably acts by binding to the proneural cluster-specific enhancers of the ac/sc complex and increasing enhancer efficiency, thereby acting as a stimulator of ac/sc expression in proneural clusters. Also required for correct development of the embryonic/larval peripheral nervous system (PNS).
Drosophila melanogaster (taxid: 7227)
>sp|Q2EI21|RESTA_XENLA RE1-silencing transcription factor A OS=Xenopus laevis GN=rest-a PE=2 SV=1 Back     alignment and function description
>sp|Q61164|CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus GN=Ctcf PE=1 SV=2 Back     alignment and function description
>sp|Q96JM2|ZN462_HUMAN Zinc finger protein 462 OS=Homo sapiens GN=ZNF462 PE=1 SV=3 Back     alignment and function description
>sp|Q8VIG1|REST_MOUSE RE1-silencing transcription factor OS=Mus musculus GN=Rest PE=2 SV=2 Back     alignment and function description
>sp|Q13127|REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 Back     alignment and function description
>sp|O54963|REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus GN=Rest PE=2 SV=1 Back     alignment and function description
>sp|Q01611|ZFY1_XENLA Zinc finger Y-chromosomal protein 1 OS=Xenopus laevis GN=zfy1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
189233785 891 PREDICTED: similar to GA11205-PA [Tribol 0.741 0.070 0.746 3e-21
357618354 635 hypothetical protein KGM_09661 [Danaus p 0.717 0.096 0.770 3e-21
242008719 1029 hypothetical protein Phum_PHUM177130 [Pe 0.741 0.061 0.698 1e-20
312380306 1403 hypothetical protein AND_07670 [Anophele 0.729 0.044 0.677 1e-20
345495386 589 PREDICTED: hypothetical protein LOC10011 0.741 0.106 0.734 2e-20
345495388 718 PREDICTED: hypothetical protein LOC10011 0.741 0.087 0.734 2e-20
170033371 513 conserved hypothetical protein [Culex qu 0.717 0.118 0.721 3e-20
328781820 735 PREDICTED: hypothetical protein LOC10057 0.741 0.085 0.718 6e-20
350409540 535 PREDICTED: hypothetical protein LOC10074 0.741 0.117 0.718 7e-20
195486187 1367 GE13631 [Drosophila yakuba] gi|194177499 0.694 0.043 0.745 8e-20
>gi|189233785|ref|XP_001814704.1| PREDICTED: similar to GA11205-PA [Tribolium castaneum] gi|270014956|gb|EFA11404.1| hypothetical protein TcasGA2_TC013578 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 52/63 (82%)

Query: 11  NWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHL 70
           NWCLKRH+NTH+KPF C LC+YKAAR ERLATHV+KVHNKR C KCSFLADD   L  H 
Sbjct: 423 NWCLKRHMNTHLKPFVCGLCDYKAARSERLATHVLKVHNKRACGKCSFLADDPAQLTVHQ 482

Query: 71  QQH 73
           Q+H
Sbjct: 483 QEH 485




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357618354|gb|EHJ71373.1| hypothetical protein KGM_09661 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242008719|ref|XP_002425148.1| hypothetical protein Phum_PHUM177130 [Pediculus humanus corporis] gi|212508842|gb|EEB12410.1| hypothetical protein Phum_PHUM177130 [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|312380306|gb|EFR26338.1| hypothetical protein AND_07670 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|345495386|ref|XP_003427497.1| PREDICTED: hypothetical protein LOC100117235 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345495388|ref|XP_001601536.2| PREDICTED: hypothetical protein LOC100117235 isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170033371|ref|XP_001844551.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167874289|gb|EDS37672.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328781820|ref|XP_003250037.1| PREDICTED: hypothetical protein LOC100578984 [Apis mellifera] Back     alignment and taxonomy information
>gi|350409540|ref|XP_003488772.1| PREDICTED: hypothetical protein LOC100742625 isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|195486187|ref|XP_002091398.1| GE13631 [Drosophila yakuba] gi|194177499|gb|EDW91110.1| GE13631 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
FB|FBgn0015371 1214 chn "charlatan" [Drosophila me 0.694 0.048 0.745 1.3e-19
UNIPROTKB|F1NBG4 394 ZFX "Uncharacterized protein" 0.694 0.149 0.403 2.7e-06
ZFIN|ZDB-GENE-031118-80 666 zfp64 "zinc finger protein 64 0.705 0.090 0.384 5.7e-06
RGD|2321501 635 Ctcfl "CCCTC-binding factor (z 0.694 0.092 0.327 6.9e-06
UNIPROTKB|H3BLX4 1449 ZNF462 "Zinc finger protein 46 0.694 0.040 0.380 7e-06
ZFIN|ZDB-GENE-110914-121 541 si:ch211-202h22.10 "si:ch211-2 0.717 0.112 0.369 7.1e-06
UNIPROTKB|F1NQX8 795 ZFX "Uncharacterized protein" 0.694 0.074 0.403 7.2e-06
UNIPROTKB|I3L710 399 LOC100624697 "Uncharacterized 0.694 0.147 0.327 7.4e-06
UNIPROTKB|E1C5J4 2410 Gga.54345 "Uncharacterized pro 0.705 0.024 0.417 7.5e-06
ZFIN|ZDB-GENE-990415-282179 znf6 "zinc finger-6 type gene" 0.670 0.318 0.375 8e-06
FB|FBgn0015371 chn "charlatan" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 247 (92.0 bits), Expect = 1.3e-19, P = 1.3e-19
 Identities = 44/59 (74%), Positives = 48/59 (81%)

Query:    12 WCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNKRICSKCSFLADDQETLNEHL 70
             W LKRHLNTH KPF C LC+YKAAR ERLATHV+KVHNKR CSKCS+LAD QE    H+
Sbjct:   509 WGLKRHLNTHTKPFVCLLCDYKAARSERLATHVLKVHNKRACSKCSYLADTQEEYQAHM 567




GO:0007422 "peripheral nervous system development" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0007399 "nervous system development" evidence=NAS
GO:0005634 "nucleus" evidence=IC
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IDA;NAS
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=IMP
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0007423 "sensory organ development" evidence=IMP
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0001654 "eye development" evidence=IMP
GO:0001078 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0042683 "negative regulation of compound eye cone cell fate specification" evidence=IMP
GO:0007458 "progression of morphogenetic furrow involved in compound eye morphogenesis" evidence=IMP
UNIPROTKB|F1NBG4 ZFX "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031118-80 zfp64 "zinc finger protein 64 homolog (mouse)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|2321501 Ctcfl "CCCTC-binding factor (zinc finger protein)-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H3BLX4 ZNF462 "Zinc finger protein 462" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-121 si:ch211-202h22.10 "si:ch211-202h22.10" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQX8 ZFX "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3L710 LOC100624697 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5J4 Gga.54345 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-282 znf6 "zinc finger-6 type gene" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7YU81CHN_DROMENo assigned EC number0.74570.69410.0485yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 85
KOG2462|consensus279 99.92
KOG2462|consensus279 99.87
KOG3576|consensus267 99.62
KOG3623|consensus1007 99.59
KOG3576|consensus267 99.56
KOG3623|consensus 1007 99.52
KOG3608|consensus 467 99.44
KOG1074|consensus 958 99.44
PHA0276855 hypothetical protein; Provisional 99.37
PHA00733128 hypothetical protein 99.32
KOG3608|consensus 467 99.26
PHA0276855 hypothetical protein; Provisional 99.16
KOG1074|consensus958 99.04
PHA0073279 hypothetical protein 98.96
PLN03086567 PRLI-interacting factor K; Provisional 98.95
PHA00733128 hypothetical protein 98.91
KOG3993|consensus 500 98.8
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.8
PHA0073279 hypothetical protein 98.61
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.61
PHA0061644 hypothetical protein 98.57
PLN03086567 PRLI-interacting factor K; Provisional 98.49
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.36
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.29
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.28
PHA0061644 hypothetical protein 98.27
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.21
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.06
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.06
smart0035526 ZnF_C2H2 zinc finger. 98.05
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.03
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.91
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.87
smart0035526 ZnF_C2H2 zinc finger. 97.59
KOG3993|consensus 500 97.5
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.46
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 97.35
COG5189423 SFP1 Putative transcriptional repressor regulating 97.24
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.14
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.02
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.02
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.98
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.45
PRK04860160 hypothetical protein; Provisional 96.34
PRK04860160 hypothetical protein; Provisional 95.85
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.73
COG5189423 SFP1 Putative transcriptional repressor regulating 95.38
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.28
KOG2186|consensus 276 94.12
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 93.82
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 93.69
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 93.49
KOG2231|consensus 669 93.12
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 92.63
KOG1146|consensus 1406 92.19
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 91.97
COG404965 Uncharacterized protein containing archaeal-type C 91.45
smart00531147 TFIIE Transcription initiation factor IIE. 91.08
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 91.02
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.89
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 89.71
PF1371736 zinc_ribbon_4: zinc-ribbon domain 89.64
KOG1146|consensus 1406 89.45
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 88.96
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 88.33
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 88.04
PF04959 214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 87.82
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 87.66
KOG4167|consensus907 87.55
PF14353128 CpXC: CpXC protein 87.21
PTZ0025590 60S ribosomal protein L37a; Provisional 87.12
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 86.77
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 86.68
PF1371937 zinc_ribbon_5: zinc-ribbon domain 86.66
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 86.36
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 86.3
KOG2482|consensus 423 86.13
PRK06266178 transcription initiation factor E subunit alpha; V 85.8
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 85.22
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 84.67
KOG2893|consensus 341 84.64
COG177355 Rubredoxin [Energy production and conversion] 84.61
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 84.36
PF1387841 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO 84.19
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 83.88
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 83.82
KOG2907|consensus116 81.59
KOG4173|consensus253 81.41
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 80.81
PRK00464154 nrdR transcriptional regulator NrdR; Validated 80.78
COG5236 493 Uncharacterized conserved protein, contains RING Z 80.32
>KOG2462|consensus Back     alignment and domain information
Probab=99.92  E-value=3.2e-25  Score=123.31  Aligned_cols=79  Identities=27%  Similarity=0.444  Sum_probs=75.2

Q ss_pred             CCCCcccccChHHHHHHHHhcCCCccCCCCccccCChHHHHHHHHhhCCC---ccCCcCccccCCHHHHHHHHhhcc---
Q psy3492           1 MPRLQVLISYNWCLKRHLNTHIKPFNCALCEYKAARPERLATHVIKVHNK---RICSKCSFLADDQETLNEHLQQHI---   74 (85)
Q Consensus         1 c~~c~~~f~~~~~l~~h~~~h~~~~~c~~c~~~f~~~~~l~~h~~~~h~~---~~C~~c~~~f~~~~~l~~h~~~h~---   74 (85)
                      |+.|+|+|.....|++|+++|+-+.+|.+||+.|..+.-|+-|+ +.|+|   |.|+.|+|+|+.+++|+.|++||.   
T Consensus       164 C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHi-RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K  242 (279)
T KOG2462|consen  164 CKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHI-RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVK  242 (279)
T ss_pred             CCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhccc-ccccCCCCccCCcccchhcchHHHHHHHHhhcCCc
Confidence            78999999999999999999998999999999999999999999 79999   999999999999999999999999   


Q ss_pred             cccCcC
Q psy3492          75 FWECSF   80 (85)
Q Consensus        75 ~~~C~~   80 (85)
                      .|+|+-
T Consensus       243 ~~qC~~  248 (279)
T KOG2462|consen  243 KHQCPR  248 (279)
T ss_pred             cccCcc
Confidence            888864



>KOG2462|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG1773 Rubredoxin [Energy production and conversion] Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF13878 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>KOG2907|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.87
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.86
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.85
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.84
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.83
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.83
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.83
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.83
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.82
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.82
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.82
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.81
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.81
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.81
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.8
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.79
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.79
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.78
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.77
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.77
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.77
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.75
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.75
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.75
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.71
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.71
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.68
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.67
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.66
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.66
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.65
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.65
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.64
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.63
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.62
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.62
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.62
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.6
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.6
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.59
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.59
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.59
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.57
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.57
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.56
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.56
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.56
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.55
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.55
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.55
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.54
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.54
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.53
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.53
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.53
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.53
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.53
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.52
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.51
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.51
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.5
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.5
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.49
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.49
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.49
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.47
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.46
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.44
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.43
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.41
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.4
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.4
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.39
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.38
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.38
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.37
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.36
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.32
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.31
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.28
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.27
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.22
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.21
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.21
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.2
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.19
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.19
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.18
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.18
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.16
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.14
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.1
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.1
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.1
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.1
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.1
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.03
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.03
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.02
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.99
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.99
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.98
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.98
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.98
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.97
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.96
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.96
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.94
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.92
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.92
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.91
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.9
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.88
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.88
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.86
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.86
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.84
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.84
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.81
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.77
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.77
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.76
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.68
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.67
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.67
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.66
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.64
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.63
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.63
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.62
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.62
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.61
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.61
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.61
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.58
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.57
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.56
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.56
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.55
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.54
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.94
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.53
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.53
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.53
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.52
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.51
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.51
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.5
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.49
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.47
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.46
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.46
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.44
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.43
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.43
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.43
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.43
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.8
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.43
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.42
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.42
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.41
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.41
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.4
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.4
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.38
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.74
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.74
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.37
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.36
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.33
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.31
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.64
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.62
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.28
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.25
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.25
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.24
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.23
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.17
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.05
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.02
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.9
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.84
2e72_A49 POGO transposable element with ZNF domain; zinc fi 97.32
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.94
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.82
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.52
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.48
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.32
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.78
2k5c_A95 Uncharacterized protein PF0385; structural genomic 94.29
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 92.77
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 92.49
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 91.76
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 91.62
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 91.35
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 90.89
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.83
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 89.4
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 89.15
2czr_A226 TBP-interacting protein; tata-binding protein (TBP 89.14
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 88.58
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 88.33
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 88.25
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 87.9
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 87.78
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 87.1
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 87.0
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 86.8
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 86.5
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 84.2
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 84.09
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 82.52
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 81.72
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 80.49
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.90  E-value=4.5e-24  Score=109.81  Aligned_cols=73  Identities=21%  Similarity=0.254  Sum_probs=69.9

Q ss_pred             CCCCcccccChHHHHHHHHhcC--CCccCCCCccccCChHHHHHHHHhhCCC---ccCCcCccccCCHHHHHHHHhhcc
Q psy3492           1 MPRLQVLISYNWCLKRHLNTHI--KPFNCALCEYKAARPERLATHVIKVHNK---RICSKCSFLADDQETLNEHLQQHI   74 (85)
Q Consensus         1 c~~c~~~f~~~~~l~~h~~~h~--~~~~c~~c~~~f~~~~~l~~h~~~~h~~---~~C~~c~~~f~~~~~l~~h~~~h~   74 (85)
                      |++|+++|.....|..|+++|+  +||.|..|++.|.....|..|+ ..|++   |.|++||+.|...+.|..|+++|+
T Consensus        25 C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~-~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~hh  102 (133)
T 2lt7_A           25 CIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHE-IHHTGERRYQCLACGKSFINYQFMSSHIKSVH  102 (133)
T ss_dssp             ETTTCCEESCHHHHHHHHHHHHCCSCEECSSSSCEESSHHHHHHHH-HHHHTCCCEEESSSCCEESSHHHHHHHHHHHT
T ss_pred             CCCCCCCcCCHHHHHHHHHHcCCCCCeeCCccCeecccccchhhhc-cccCCCccccCCCCCCCcCCHHHHHHHhHHhc
Confidence            7899999999999999999998  9999999999999999999999 79987   999999999999999999999875



>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1 Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.76
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.67
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.35
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.26
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.24
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.24
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.21
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.21
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.2
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.19
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.17
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.16
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.15
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.15
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.15
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.14
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.14
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.13
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.13
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.11
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.09
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.06
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.02
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.97
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.88
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.87
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.86
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.78
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.77
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.76
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.75
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.74
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.73
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.69
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.68
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.62
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.62
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.62
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.57
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.53
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.44
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.43
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.39
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.38
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.28
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.23
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.17
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.03
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.98
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.95
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.93
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.91
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.83
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.75
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.72
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.7
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.66
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.66
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.65
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.64
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.52
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.46
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.39
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 97.3
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.29
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.24
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.23
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.22
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.2
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 97.11
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.1
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.09
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.08
d1y0jb136 U-shaped transcription factor, different fingers { 97.07
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.07
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.0
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.95
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.9
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.82
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.72
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.69
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.56
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.47
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.45
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.43
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.36
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.15
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.91
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.11
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 94.5
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.19
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 93.56
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 93.31
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.45
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.24
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.75
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 90.81
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 90.03
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.64
d1fu9a_36 U-shaped transcription factor, different fingers { 88.18
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 88.11
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 87.81
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 87.58
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 87.04
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 86.7
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 84.48
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 84.42
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 84.33
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 83.81
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 83.52
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 83.38
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76  E-value=3.4e-19  Score=77.39  Aligned_cols=49  Identities=20%  Similarity=0.383  Sum_probs=43.5

Q ss_pred             CCccCCCCccccCChHHHHHHHHhhCCC---ccCCcCccccCCHHHHHHHHhhc
Q psy3492          23 KPFNCALCEYKAARPERLATHVIKVHNK---RICSKCSFLADDQETLNEHLQQH   73 (85)
Q Consensus        23 ~~~~c~~c~~~f~~~~~l~~h~~~~h~~---~~C~~c~~~f~~~~~l~~h~~~h   73 (85)
                      +||.|. ||+.|.....|..|+ ++|+|   |.|++||+.|...+.|..|+++|
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~-~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHM-SMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHH-HHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             cCCCCC-CCCeECCHHHhHHHh-hccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            688994 999999999999998 78888   89999999999999999999876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure