Diaphorina citri psyllid: psy3499


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MPHEPSVLIEGVLFRARYLGSTQLVCEGQPTKSTRMMQAEEAVSRIKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEIASAPD
ccccccHHHHHHEHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEccEEEEEEccccccccccccccccccccEEEEEEEccccccccc
***EPSVLIEGVLFRARYLGSTQLVCE**************AVSRIKEIMMDHALRTISYIADIGDLVVLMARRRFV****************ICHVFES********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPHEPSVLIEGVLFRARYLGSTQLVCEGQPTKSTRMMQAEEAVSRIKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEIASAPD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008105 [BP]asymmetric protein localizationprobableGO:0033036, GO:0008104, GO:0008150, GO:0051179
GO:0030140 [CC]trans-Golgi network transport vesicleprobableGO:0030135, GO:0043229, GO:0030133, GO:0043227, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0031982, GO:0016023, GO:0031410, GO:0031988, GO:0044431, GO:0005794, GO:0005798, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0050839 [MF]cell adhesion molecule bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0000138 [CC]Golgi trans cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0048749 [BP]compound eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007163 [BP]establishment or maintenance of cell polarityprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0040026 [BP]positive regulation of vulval developmentprobableGO:0051094, GO:0050793, GO:0040028, GO:0048580, GO:0008150, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0061062, GO:0050789
GO:0050975 [BP]sensory perception of touchprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0016081 [BP]synaptic vesicle docking involved in exocytosisprobableGO:0019226, GO:0003001, GO:0035637, GO:0051648, GO:0006904, GO:0007268, GO:0022406, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0051640, GO:0097479, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0048278, GO:0044765, GO:0044763, GO:0007269, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0016079, GO:0008150, GO:0006836
GO:0016080 [BP]synaptic vesicle targetingprobableGO:0019226, GO:0007269, GO:0035637, GO:0051649, GO:0006903, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0097480, GO:0097479, GO:0065008, GO:0003001, GO:0006810, GO:0050877, GO:0003008, GO:0009987, GO:0023061, GO:0044765, GO:0044763, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0016079, GO:0008150, GO:0006836
GO:0007270 [BP]neuron-neuron synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DBB, chain A
Confidence level:very confident
Coverage over the Query: 6-78,89-104
View the alignment between query and template
View the model in PyMOL