Required specifically for the determination of 3 vulval precursor cell fates P5.p, P6.p and P7.p during late second and early third larval stages; required for basolateral localization of receptor tyrosine kinase let-23. Could have a general but redundant role in development, functioning in diverse cell lineages to control cell fates. Caenorhabditis elegans (taxid: 6239)
>sp|O35431|APBA2_RAT Amyloid beta A4 precursor protein-binding family A member 2 OS=Rattus norvegicus GN=Apba2 PE=1 SV=1
Putative function in synaptic vesicle exocytosis by binding to STXBP1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.
Rattus norvegicus (taxid: 10116)
>sp|Q5RD33|APBA2_PONAB Amyloid beta A4 precursor protein-binding family A member 2 OS=Pongo abelii GN=APBA2 PE=2 SV=1
Putative function in synaptic vesicle exocytosis by binding to STXBP1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.
Pongo abelii (taxid: 9601)
>sp|Q99767|APBA2_HUMAN Amyloid beta A4 precursor protein-binding family A member 2 OS=Homo sapiens GN=APBA2 PE=1 SV=3
Putative function in synaptic vesicle exocytosis by binding to STXBP1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.
Homo sapiens (taxid: 9606)
>sp|Q02410|APBA1_HUMAN Amyloid beta A4 precursor protein-binding family A member 1 OS=Homo sapiens GN=APBA1 PE=1 SV=3
Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.
Homo sapiens (taxid: 9606)
>sp|B2RUJ5|APBA1_MOUSE Amyloid beta A4 precursor protein-binding family A member 1 OS=Mus musculus GN=Apba1 PE=2 SV=2
Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-AAP.
Mus musculus (taxid: 10090)
>sp|O35430|APBA1_RAT Amyloid beta A4 precursor protein-binding family A member 1 OS=Rattus norvegicus GN=Apba1 PE=1 SV=1
Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-AAP.
Rattus norvegicus (taxid: 10116)
>sp|P98084|APBA2_MOUSE Amyloid beta A4 precursor protein-binding family A member 2 OS=Mus musculus GN=Apba2 PE=1 SV=2
Putative function in synaptic vesicle exocytosis by binding to STXBP1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.
Mus musculus (taxid: 10090)
>sp|O70248|APBA3_RAT Amyloid beta A4 precursor protein-binding family A member 3 OS=Rattus norvegicus GN=Apba3 PE=2 SV=2
May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP. May enhance the activity of HIF1A in macrophages by inhibiting the activity of HIF1AN.
Rattus norvegicus (taxid: 10116)
>sp|O96018|APBA3_HUMAN Amyloid beta A4 precursor protein-binding family A member 3 OS=Homo sapiens GN=APBA3 PE=1 SV=1
May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP. May enhance the activity of HIF1A in macrophages by inhibiting the activity of HIF1AN.
Homo sapiens (taxid: 9606)
Close Homologs in the Non-Redundant Database Detected by BLAST
Score = 167 bits (426), Expect = 5e-55
Identities = 68/141 (48%), Positives = 79/141 (56%), Gaps = 39/141 (27%)
Query: 5 PSVLIEGVLFRARYLGSTQLVCEGQPTKSTRMMQAEEAVSRIK----------------- 47
P LI+GV+F A YLGSTQL+ E PTKS RM QA+EAVSRIK
Sbjct: 1 PEDLIDGVIFGANYLGSTQLLSERNPTKSVRMQQAQEAVSRIKAPEGESQPSTEVDLFIS 60
Query: 48 ------------EIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEP-------PKIS 88
E MMDHALRTISYIADIG++VVLMARRR + E +
Sbjct: 61 TERIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSSSQECIETTPPAQEGK 120
Query: 89 RTPKMICHVFESDE---IASA 106
R KMICHVFES++ IA +
Sbjct: 121 RQYKMICHVFESEDAQLIAQS 141
The function of the neuronal protein X11 is unknown to date. X11 has a PTB domain followed by two PDZ domains. PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains. This cd is part of the Dab-like subgroup. Length = 161
Score = 34.9 bits (81), Expect = 0.002
Identities = 37/132 (28%), Positives = 57/132 (43%), Gaps = 40/132 (30%)
Query: 3 HEPSVLIEG-VLFRARYLGSTQ--------LVCEG--------QPTKS--TRMMQAEEAV 43
H P LI+G V++ ++LG T+ +V E Q KS ++ + E +
Sbjct: 2 HPPEALIKGHVVYLVKFLGCTEVDQPKGTEVVKEAIRKLKFARQIKKSEGAKLPKVELQI 61
Query: 44 S---------RIKEIMMDHALRTISYIAD-IGDLVVLMARRRFVSQEADEPPKISRTPKM 93
S + KEIM L IS+ AD D +R S A K S + K
Sbjct: 62 SIDGVKIQDPKTKEIMHQFPLHRISFCADDKTD-------KRIFSFIA----KDSESNKH 110
Query: 94 ICHVFESDEIAS 105
+C VF+S+++A
Sbjct: 111 LCFVFDSEKLAE 122
CED6 (also known as GULP1: engulfment adaptor PTB domain containing 1) is an adaptor protein involved in the specific recognition and engulfment of apoptotic cells. CED6 has been shown to interact with the cytoplasmic tail of another protein involved in the engulfment of apoptotic cells, CED1. CED6 has a C-terminal PTB domain, which can bind to NPXY motifs. PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains. This cd is part of the Dab-like subgroup. Length = 144
>gnl|CDD|241304 cd01274, PTB_Anks, Ankyrin repeat and sterile alpha motif (SAM) domain-containing (Anks) protein family Phosphotyrosine-binding (PTB) domain
Score = 34.5 bits (80), Expect = 0.003
Identities = 33/130 (25%), Positives = 53/130 (40%), Gaps = 40/130 (30%)
Query: 3 HEPSVLIEG-VLFRARYLGSTQLVCEGQPTKSTR-MMQ-------AEEAVSRI------- 46
H P LI G V + A YLGST L+ E + T+ST+ Q + + I
Sbjct: 5 HSPEKLITGSVNYEAHYLGST-LIKELRGTESTKDACQKLKKSTEEMKKIPTIILSISYK 63
Query: 47 ---------KEIMMDHALRTISYIA-DIGDLVVLMARRRFVSQEADEPPKISRTPKMICH 96
K ++ +H +R IS D DL +++++ +T CH
Sbjct: 64 GVKFIDATTKNLICEHEIRNISCACQDPEDLNTFA----YITKDL-------KTDHHYCH 112
Query: 97 VF--ESDEIA 104
VF + ++A
Sbjct: 113 VFCVLTVDLA 122
Both AIDA-1b (AbetaPP intracellular domain-associated protein 1b) and Odin (also known as ankyrin repeat and sterile alpha motif domain-containing 1A; ANKS1A) belong to the Anks protein family. Both of these family members interacts with the EphA8 receptor. Ank members consists of ankyrin repeats, a SAM domain and a C-terminal PTB domain which is crucial for interaction with the juxtamembrane (JM) region of EphA8. PTB domains are classified into three groups, namely, phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains of which the Anks PTB is a member. PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains. This cd is part of the Dab-like subgroup. Length = 146
X11 Phosphotyrosine-binding (PTB) domain. The neuronal protein X11 has a PTB domain followed by two PDZ domains. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether. X11 binds to the cytoplasmic domain of the beta-amyloid precursor protein (beta-APP) and does not require the substrate to be tyrosine-phosphorylated for binding.
SHC phosphotyrosine-binding (PTB) domain. SHC is a substrate for receptor tyrosine kinases, which can interact with phosphoproteins at NPXY motifs. SHC contains an PTB domain followed by an SH2 domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
CED-6 Phosphotyrosine-binding (PTB) domain. CED6 is an adaptor protein involved in the engulfment of apoptotic cells. It has a C-terminal PTB domain, which can bind to NPXY motifs. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
>PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains
; InterPro: IPR006020 The PI domain has a similar structure to the insulin receptor substrate-1 PTB domain, a 7-stranded beta-sandwich, capped by a C-terminal helix. However, the PI domain contains an additional short N-terminal helix and a large insertion between strands 1 and 2, which forms a helix and 2 long connecting loops. The substrate peptide fits into a surface cleft formed from the C-terminal helix and strand 5 [].; GO: 0005515 protein binding; PDB: 1WGU_A 2YT0_A 2YT1_A 2YSZ_A 2ROZ_B 3SO6_A 2DYQ_A 1AQC_A 1X11_B 1WJ1_A ....
Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
AIDA-1b Phosphotyrosine-binding (PTB) domain. AIDA-1b is an amyloid-beta precursor protein interacting protein. It consists of ankyrin repeats, a SAM domain and a C-terminal PTB domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
Phosphotyrosine-binding (PTB) domain; PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. The PTB domain of SHC binds to a NPXpY sequence. More recent studies have found that some types of PTB domains such as the neuronal protein X11 and in the cell-fate determinant protein Numb can bind to peptides which are not tyrosine phosphorylated; whereas, other PTB domains can bind motifs lacking tyrosine residues altogether.
Numb Phosphotyrosine-binding (PTB) domain. Numb is a membrane associated adaptor protein, which is a determinant of asymmetric cell division. Numb has an N-terminal PTB domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain. DYC-1 contains an N-terminal PTB domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. The PTB domains of both SHC and IRS-1, for example, bind to a NPXpY sequence. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated; whereas, other PTB domains can bind motifs lacking tyrosine residues altogether.
Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain. Fe65 is an amyloid beta A4 precursor (APP) protein-binding. It contains an N-terminal WW domain followed by two PTB domains. The C-terminal PTB domain is responsible for APP binding. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
Fe65 C-terminal Phosphotyrosine-binding (PTB) domain. Fe65 is an amyloid beta A4 precursor (APP) protein-binding. It contains an N-terminal WW domain followed by two PTB domains. The C-terminal PTB domain is responsible for APP binding. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
>cd01212 JIP JNK-interacting protein (JIP) Phosphotyrosine-binding (PTB) domain
JNK-interacting protein (JIP) Phosphotyrosine-binding (PTB) domain. JIP is a mitogen-activated protein kinase scaffold protein. JIP consists of a C-terminal SH3 domain, followed by a PTB domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
>cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain
Disabled (Dab) Phosphotyrosine-binding domain. Dab is a cystosolic adaptor protein, which binds to the cytoplasmic tails of lipoprotein receptors, such as ApoER2 and VLDLR, via its PTB domain. The dab PTB domain has a preference for unphosphorylated tyrosine within an NPxY motif. Additionally, the Dab PTB domain, which is structurally similar to PH domains, binds to phosphatidlyinositol phosphate 4,5 bisphosphate in a manner characteristic of phosphoinositide binding PH domains.
CG8312 Phosphotyrosine-binding (PTB) domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens}
