Diaphorina citri psyllid: psy3500

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MYHCKTCSTLSRPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNHLQSHG
cccccccccccccccccccccccccccccccccccHHHHccccccccccccccHHHcccccHHHHHHHccccccccccccHHHHHcccHHHHHHHccc
MYHCKTCSTLSRPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNHLQ***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYHCKTCSTLSRPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNHLQSHG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein 271 May be involved in transcriptional regulation.confidentQ5R5U3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 1-97
View the alignment between query and template
View the model in PyMOL