Diaphorina citri psyllid: psy3507

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----

MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHHHccccccccccccHHHHcccHHHHHHHHccc

MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQ***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG

Annotation	Function Description	Confidence Level	Reference Protein
Zinc finger protein 271	May be involved in transcriptional regulation.	confident	Q5R5U3

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0010468 [BP]	regulation of gene expression	probable	GO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222

No EC number assigned to the protein, probably not an enzyme!

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 26-134
View the alignment between query and template
View the model in PyMOL