Psyllid ID: psy3507


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccHHHHHHHccccccccccccHHHHcccHHHHHHHHccc
ccccccccccccccccccccHHcHHHEHHHHcccccccccccccccEcccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHc
MHNYLVCTAsiglknpftlatCIHCRLLLVPTAEELMYhcktcstvshpnisykytcyacDYHTLMSEDMKKHmrkhtgekpykceycaysctqssaLKIHErkhtgdkpyicqqcRDTFSSLYLFRNRLQSHG
MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCstvshpnisYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG
MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG
***YLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMS************EKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRN******
MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQ***
MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG
MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQ***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHNYLVCTASIGLKNPFTLATCIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query134 2.2.26 [Sep-21-2011]
Q9QZ48 569 Zinc finger and BTB domai yes N/A 0.552 0.130 0.428 4e-16
O88939 569 Zinc finger and BTB domai yes N/A 0.552 0.130 0.428 4e-16
O95365 584 Zinc finger and BTB domai yes N/A 0.552 0.126 0.428 5e-16
O93567 546 Zinc finger and BTB domai yes N/A 0.455 0.111 0.484 1e-15
Q5R5U3 672 Zinc finger protein 271 O yes N/A 0.417 0.083 0.567 3e-15
Q14591 655 Zinc finger protein 271 O no N/A 0.649 0.132 0.459 6e-15
Q13360 481 Zinc finger protein 177 O no N/A 0.529 0.147 0.430 3e-14
Q8TC21504 Zinc finger protein 596 O no N/A 0.462 0.123 0.465 4e-13
Q14584549 Zinc finger protein 266 O no N/A 0.537 0.131 0.455 4e-13
Q9Z1D9521 Zinc finger protein 394 O no N/A 0.723 0.186 0.370 4e-13
>sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=2 SV=1 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/77 (42%), Positives = 47/77 (61%)

Query: 57  CYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQC 116
           C  C+     +  + +H+R HTGEKPY+C  C    T+   LK+H RKHTG+KPY+CQQC
Sbjct: 378 CPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQC 437

Query: 117 RDTFSSLYLFRNRLQSH 133
              F+  Y  +N ++ H
Sbjct: 438 GAAFAHNYDLKNHMRVH 454




Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals (By similarity). Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
Rattus norvegicus (taxid: 10116)
>sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 Back     alignment and function description
>sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 Back     alignment and function description
>sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description
>sp|Q14591|ZN271_HUMAN Zinc finger protein 271 OS=Homo sapiens GN=ZNF271 PE=2 SV=4 Back     alignment and function description
>sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=2 SV=4 Back     alignment and function description
>sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 Back     alignment and function description
>sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
72028083 939 PREDICTED: uncharacterized protein LOC59 0.694 0.099 0.411 5e-15
18539217 939 enhancer binding protein [Paracentrotus 0.694 0.099 0.411 6e-15
291223509 852 PREDICTED: enhancer binding protein-like 0.723 0.113 0.411 8e-15
16758916 569 zinc finger and BTB domain-containing pr 0.552 0.130 0.428 3e-14
3599511 565 leukemia/lymphoma related factor LRF [Mu 0.552 0.130 0.428 3e-14
149034453 569 zinc finger and BTB domain containing 7a 0.552 0.130 0.428 3e-14
402903754 584 PREDICTED: zinc finger and BTB domain-co 0.552 0.126 0.428 3e-14
74191949 569 unnamed protein product [Mus musculus] 0.552 0.130 0.428 3e-14
117647238 569 zinc finger and BTB domain-containing pr 0.552 0.130 0.428 3e-14
7705375 584 zinc finger and BTB domain-containing pr 0.552 0.126 0.428 3e-14
>gi|72028083|ref|XP_797592.1| PREDICTED: uncharacterized protein LOC593001 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
 Score = 85.9 bits (211), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 9/102 (8%)

Query: 32  TAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYS 91
           T+ EL  H K   T   P     + C  CDY ++ +  +K+HMR HTGEKPYKC  C Y+
Sbjct: 511 TSGELGRHMKYMHTHEKP-----HKCPLCDYLSVEASKIKRHMRSHTGEKPYKCTLCEYA 565

Query: 92  CTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSH 133
            T +  LK H R HTG++P+ C QC  +FS     ++ L+ H
Sbjct: 566 STDNYKLKRHMRVHTGERPFNCSQCDQSFSQ----KSSLKEH 603




Source: Strongylocentrotus purpuratus

Species: Strongylocentrotus purpuratus

Genus: Strongylocentrotus

Family: Strongylocentrotidae

Order: Echinoida

Class: Echinoidea

Phylum: Echinodermata

Superkingdom: Eukaryota

>gi|18539217|emb|CAD22532.1| enhancer binding protein [Paracentrotus lividus] Back     alignment and taxonomy information
>gi|291223509|ref|XP_002731752.1| PREDICTED: enhancer binding protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|16758916|ref|NP_446454.1| zinc finger and BTB domain-containing protein 7A [Rattus norvegicus] gi|46397077|sp|Q9QZ48.1|ZBT7A_RAT RecName: Full=Zinc finger and BTB domain-containing protein 7A; AltName: Full=Leukemia/lymphoma-related factor; AltName: Full=Osteoclast-derived zinc finger protein gi|6329066|dbj|BAA86393.1| osteoclast-derived zinc finger (OCZF) protein [Rattus norvegicus] Back     alignment and taxonomy information
>gi|3599511|gb|AAC35367.1| leukemia/lymphoma related factor LRF [Mus musculus] Back     alignment and taxonomy information
>gi|149034453|gb|EDL89190.1| zinc finger and BTB domain containing 7a [Rattus norvegicus] Back     alignment and taxonomy information
>gi|402903754|ref|XP_003914723.1| PREDICTED: zinc finger and BTB domain-containing protein 7A isoform 1 [Papio anubis] gi|402903756|ref|XP_003914724.1| PREDICTED: zinc finger and BTB domain-containing protein 7A isoform 2 [Papio anubis] gi|387539686|gb|AFJ70470.1| zinc finger and BTB domain-containing protein 7A [Macaca mulatta] Back     alignment and taxonomy information
>gi|74191949|dbj|BAE32917.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|117647238|ref|NP_034861.3| zinc finger and BTB domain-containing protein 7A [Mus musculus] gi|205371830|sp|O88939.2|ZBT7A_MOUSE RecName: Full=Zinc finger and BTB domain-containing protein 7A; AltName: Full=Leukemia/lymphoma-related factor; AltName: Full=POZ and Krueppel erythroid myeloid ontogenic factor; Short=POK erythroid myeloid ontogenic factor; Short=Pokemon gi|148699508|gb|EDL31455.1| mCG12141 [Mus musculus] gi|187952921|gb|AAI38525.1| Zbtb7a protein [Mus musculus] gi|219518614|gb|AAI45312.1| Zinc finger and BTB domain containing 7a [Mus musculus] Back     alignment and taxonomy information
>gi|7705375|ref|NP_056982.1| zinc finger and BTB domain-containing protein 7A [Homo sapiens] gi|114674703|ref|XP_524058.2| PREDICTED: zinc finger and BTB domain-containing protein 7A [Pan troglodytes] gi|46397100|sp|O95365.1|ZBT7A_HUMAN RecName: Full=Zinc finger and BTB domain-containing protein 7A; AltName: Full=Factor binding IST protein 1; Short=FBI-1; AltName: Full=Factor that binds to inducer of short transcripts protein 1; AltName: Full=HIV-1 1st-binding protein 1; AltName: Full=Leukemia/lymphoma-related factor; AltName: Full=POZ and Krueppel erythroid myeloid ontogenic factor; Short=POK erythroid myeloid ontogenic factor; Short=Pokemon; AltName: Full=TTF-I-interacting peptide 21; Short=TIP21; AltName: Full=Zinc finger protein 857A gi|3860089|gb|AAC72973.1| HIV-1 inducer of short transcripts binding protein [Homo sapiens] gi|109731291|gb|AAI13512.1| Zinc finger and BTB domain containing 7A [Homo sapiens] gi|119589673|gb|EAW69267.1| zinc finger and BTB domain containing 7A, isoform CRA_b [Homo sapiens] gi|119589674|gb|EAW69268.1| zinc finger and BTB domain containing 7A, isoform CRA_b [Homo sapiens] gi|119589676|gb|EAW69270.1| zinc finger and BTB domain containing 7A, isoform CRA_b [Homo sapiens] gi|119589677|gb|EAW69271.1| zinc finger and BTB domain containing 7A, isoform CRA_b [Homo sapiens] gi|119589678|gb|EAW69272.1| zinc finger and BTB domain containing 7A, isoform CRA_b [Homo sapiens] gi|307686181|dbj|BAJ21021.1| zinc finger and BTB domain containing 7A [synthetic construct] gi|410214634|gb|JAA04536.1| zinc finger and BTB domain containing 7A [Pan troglodytes] gi|410248790|gb|JAA12362.1| zinc finger and BTB domain containing 7A [Pan troglodytes] gi|410340211|gb|JAA39052.1| zinc finger and BTB domain containing 7A [Pan troglodytes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
ZFIN|ZDB-GENE-050913-150188 zgc:113372 "zgc:113372" [Danio 0.783 0.558 0.428 7.5e-18
ZFIN|ZDB-GENE-050913-148315 zgc:113377 "zgc:113377" [Danio 0.783 0.333 0.392 3.2e-17
ZFIN|ZDB-GENE-050913-91309 zgc:113886 "zgc:113886" [Danio 0.783 0.339 0.392 4.1e-17
ZFIN|ZDB-GENE-080219-33334 zgc:171599 "zgc:171599" [Danio 0.753 0.302 0.428 4.5e-17
UNIPROTKB|Q14591 655 ZNF271 "Zinc finger protein 27 0.649 0.132 0.459 6.3e-17
UNIPROTKB|F1SAJ6 670 ZNF35 "Uncharacterized protein 0.708 0.141 0.445 8.4e-17
UNIPROTKB|J9P3X3 703 LOC100684599 "Uncharacterized 0.708 0.135 0.445 9.1e-17
UNIPROTKB|G3MXV1319 ZNF705A "Uncharacterized prote 0.589 0.247 0.455 1.3e-16
UNIPROTKB|G3N2G8 759 ZNF397 "Zinc finger protein 39 0.708 0.125 0.436 1.7e-16
ZFIN|ZDB-GENE-071004-118281 zgc:174224 "zgc:174224" [Danio 0.783 0.373 0.398 1.8e-16
ZFIN|ZDB-GENE-050913-150 zgc:113372 "zgc:113372" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 217 (81.4 bits), Expect = 7.5e-18, P = 7.5e-18
 Identities = 48/112 (42%), Positives = 59/112 (52%)

Query:    22 CIHCRLLLVPTAEELMYHCKTCSTVSHPNISYKYTCYACDYHTLMSEDMKKHMRKHTGEK 81
             C+ C    V TA +L  H      V H   + KYTC  C       +++K+H R HTGEK
Sbjct:    77 CMTCSQTFV-TAGQLKRH-----QVIHAGET-KYTCSHCGKAFTQVQNLKRHERIHTGEK 129

Query:    82 PYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSH 133
             PYKC +C  S TQ   LK HER HTG+KPY CQQC   F+ L   +     H
Sbjct:   130 PYKCSHCDKSFTQLPNLKCHERIHTGEKPYRCQQCLKRFTQLSQLKKHTNMH 181


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-050913-148 zgc:113377 "zgc:113377" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-91 zgc:113886 "zgc:113886" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080219-33 zgc:171599 "zgc:171599" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q14591 ZNF271 "Zinc finger protein 271" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAJ6 ZNF35 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P3X3 LOC100684599 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXV1 ZNF705A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3N2G8 ZNF397 "Zinc finger protein 397" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-118 zgc:174224 "zgc:174224" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R5U3ZN271_PONABNo assigned EC number0.56710.41790.0833yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 4e-04
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 35.4 bits (82), Expect = 4e-04
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 69 DMKKHMRKHTGEKPYKCEYCAYSCTQ 94
          ++++HMR HTGEKPYKC  C  S + 
Sbjct: 1  NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 134
KOG2462|consensus279 99.95
KOG2462|consensus279 99.94
KOG1074|consensus 958 99.76
KOG3608|consensus 467 99.75
KOG3576|consensus267 99.72
KOG3576|consensus267 99.7
KOG1074|consensus958 99.69
KOG3623|consensus1007 99.68
KOG3623|consensus 1007 99.63
KOG3608|consensus467 99.48
PHA00733128 hypothetical protein 99.34
PLN03086567 PRLI-interacting factor K; Provisional 99.32
PLN03086567 PRLI-interacting factor K; Provisional 99.22
PHA0276855 hypothetical protein; Provisional 99.19
PHA00733128 hypothetical protein 99.12
PHA0276855 hypothetical protein; Provisional 99.1
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.01
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.89
KOG3993|consensus 500 98.81
PHA0073279 hypothetical protein 98.73
KOG3993|consensus500 98.65
PHA0061644 hypothetical protein 98.65
PHA0061644 hypothetical protein 98.58
PHA0073279 hypothetical protein 98.53
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.52
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.34
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.31
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.29
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.26
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.23
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.21
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.93
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.9
COG5189423 SFP1 Putative transcriptional repressor regulating 97.89
smart0035526 ZnF_C2H2 zinc finger. 97.84
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.56
COG5189423 SFP1 Putative transcriptional repressor regulating 97.56
PRK04860160 hypothetical protein; Provisional 97.39
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.37
smart0035526 ZnF_C2H2 zinc finger. 97.36
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.19
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.09
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.06
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.01
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.97
PRK04860160 hypothetical protein; Provisional 96.87
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.75
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 96.71
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.68
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.59
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 96.08
KOG2893|consensus 341 96.0
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 95.87
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 95.21
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.11
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 95.01
KOG2231|consensus 669 94.93
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.8
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.71
COG404965 Uncharacterized protein containing archaeal-type C 94.56
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 94.53
COG5048467 FOG: Zn-finger [General function prediction only] 94.3
COG5048 467 FOG: Zn-finger [General function prediction only] 94.23
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 94.18
PF1371736 zinc_ribbon_4: zinc-ribbon domain 94.12
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 94.0
KOG2893|consensus 341 93.99
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 93.94
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 93.93
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 93.87
KOG1146|consensus 1406 93.68
PF1371937 zinc_ribbon_5: zinc-ribbon domain 93.55
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 92.92
KOG2186|consensus 276 92.8
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 92.56
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 92.52
KOG1146|consensus1406 92.42
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 92.38
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 92.36
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 92.28
KOG2907|consensus116 91.96
KOG2482|consensus423 91.66
PRK00464154 nrdR transcriptional regulator NrdR; Validated 91.47
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.2
KOG2231|consensus 669 91.13
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 91.06
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 90.74
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 90.63
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 90.39
KOG4173|consensus253 90.15
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 90.09
COG404965 Uncharacterized protein containing archaeal-type C 89.96
PF14353128 CpXC: CpXC protein 89.63
PHA0062659 hypothetical protein 89.51
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 89.31
COG1592166 Rubrerythrin [Energy production and conversion] 88.96
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 88.91
smart00531147 TFIIE Transcription initiation factor IIE. 88.41
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 87.78
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 87.08
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 86.82
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 86.7
COG1198 730 PriA Primosomal protein N' (replication factor Y) 86.67
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 86.65
PRK0043250 30S ribosomal protein S27ae; Validated 86.4
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 86.21
PRK06266178 transcription initiation factor E subunit alpha; V 85.7
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 85.68
TIGR00595 505 priA primosomal protein N'. All proteins in this f 85.6
KOG2785|consensus 390 85.52
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 85.48
PRK06266178 transcription initiation factor E subunit alpha; V 85.21
COG177355 Rubredoxin [Energy production and conversion] 84.91
smart00531147 TFIIE Transcription initiation factor IIE. 84.81
TIGR00686109 phnA alkylphosphonate utilization operon protein P 83.73
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 83.49
KOG4167|consensus907 83.38
KOG2807|consensus378 83.38
PRK0967872 DNA-binding transcriptional regulator; Provisional 83.26
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 83.0
PRK10220111 hypothetical protein; Provisional 82.9
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 82.9
KOG2186|consensus 276 82.85
COG4530129 Uncharacterized protein conserved in bacteria [Fun 82.8
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 81.86
PF1436935 zf-RING_3: zinc-finger 81.71
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 81.56
COG1198 730 PriA Primosomal protein N' (replication factor Y) 81.21
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 81.07
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 80.97
COG4957148 Predicted transcriptional regulator [Transcription 80.11
PRK04023 1121 DNA polymerase II large subunit; Validated 80.09
>KOG2462|consensus Back     alignment and domain information
Probab=99.95  E-value=1.3e-28  Score=163.95  Aligned_cols=114  Identities=23%  Similarity=0.448  Sum_probs=100.1

Q ss_pred             ceecCccccc----------ccccCCC---CccccCCCCCCccc---------CCCCcceeeCCCCCccCChHHHHHHHH
Q psy3507          18 TLATCIHCRL----------LLVPTAE---ELMYHCKTCSTVSH---------PNISYKYTCYACDYHTLMSEDMKKHMR   75 (134)
Q Consensus        18 ~~~~C~~C~~----------h~~~h~~---~~~~~C~~C~~~f~---------~~~~~~~~C~~C~~~f~~~~~l~~H~~   75 (134)
                      ..++|+.|++          |..+|..   .+.+.|++||+.|.         .+...+++|.+||+.|...-.|..|++
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiR  208 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIR  208 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccc
Confidence            3577888844          4444432   67799999999998         445578999999999999999999999


Q ss_pred             HhcCCCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHHH
Q psy3507          76 KHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQ  131 (134)
Q Consensus        76 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~~  131 (134)
                      +|+||+||.|+.|+++|..+++|+.|+++|.+.|+|+|..|+|+|...+.|.+|..
T Consensus       209 THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  209 THTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999999975



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>KOG2907|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>COG1773 Rubredoxin [Energy production and conversion] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>KOG2807|consensus Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14369 zf-RING_3: zinc-finger Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>COG4957 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-14
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-13
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-09
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-09
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-09
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-09
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 4e-09
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-09
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-09
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 6e-09
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 7e-09
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 1e-08
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-08
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-08
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-07
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 9e-07
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 5e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 6e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 7e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 4e-05
2yta_A41 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-05
2en1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ysv_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-04
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 72.4 bits (176), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 34/79 (43%), Positives = 46/79 (58%) Query: 55 YTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQ 114 Y C C +D+ +H R HTGEKPYKC C S +Q + L+ H+R HTG+KPY C Sbjct: 50 YKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACP 109 Query: 115 QCRDTFSSLYLFRNRLQSH 133 +C +FS L R ++H Sbjct: 110 ECGKSFSQLAHLRAHQRTH 128
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2YTA|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 3 In Zinc Finger Protein 32 Length = 41 Back     alignment and structure
>pdb|2EN1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 563- 595) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2YSV|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 17 In Zinc Finger Protein 473 Length = 42 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-20
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-20
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-18
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-18
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-18
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-17
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-16
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 3e-16
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-11
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 6e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-11
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-16
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-16
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-09
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-14
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-15
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-14
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-14
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-14
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-14
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-14
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-14
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-14
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-14
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-14
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-14
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-14
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-14
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-13
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 1e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-11
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-13
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-13
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-13
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-13
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-13
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-13
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-13
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 5e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-13
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-13
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 9e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 6e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-06
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 1e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 8e-04
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
 Score = 77.5 bits (192), Expect = 3e-20
 Identities = 18/57 (31%), Positives = 26/57 (45%)

Query: 55  YTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTGDKPY 111
             C  C Y       ++ H R H  ++P+KC YC++   Q S L  H +K  GD   
Sbjct: 10  EKCSECSYSCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMSG 66


>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.95
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.94
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.93
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.93
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.91
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.91
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.9
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.9
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.9
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.89
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.88
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.86
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.85
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.84
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.83
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.83
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.82
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.81
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.81
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.78
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.78
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.77
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.76
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.74
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.74
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.74
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.73
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.72
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.71
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.7
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.7
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.7
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.7
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.68
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.68
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.68
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.67
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.66
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.66
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.66
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.66
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.65
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.65
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.64
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.62
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.61
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.61
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.6
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.6
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.59
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.59
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.59
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.55
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.54
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.54
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.54
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.52
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.51
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.48
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.48
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.48
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.48
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.48
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.48
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.48
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.48
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.47
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.47
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.47
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.47
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.47
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.47
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.46
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.45
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.44
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.44
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.43
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.43
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.42
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.41
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.39
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.39
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.38
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.38
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.37
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.37
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.36
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.36
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.35
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.35
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.34
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.34
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.32
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.32
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.32
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.31
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.3
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.27
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.27
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.26
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.26
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.25
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.24
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.23
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.21
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.21
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.21
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.21
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.2
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.2
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.2
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.2
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.15
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.04
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.03
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.03
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.02
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.01
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.01
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.01
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.01
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.98
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.97
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.96
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.96
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.96
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.94
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.94
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.92
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.9
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.89
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.89
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.87
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.87
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.87
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.83
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.82
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.79
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.77
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.72
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.72
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.71
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.7
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 98.15
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.69
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.69
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.68
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.67
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.66
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.61
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.61
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.6
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.6
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.59
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.58
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.58
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.56
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.55
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.54
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.54
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.54
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.94
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.93
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.5
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.5
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.49
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.48
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.47
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.47
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.46
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.46
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.84
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.45
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.44
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.44
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.43
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.81
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.43
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.39
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.38
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.59
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.17
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.14
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.91
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.56
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.43
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.92
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.91
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.9
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.22
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.09
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 94.35
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 93.64
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 93.61
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.59
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.44
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.32
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 92.45
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 91.61
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 90.91
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 90.86
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.77
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 90.56
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 90.37
1wil_A89 KIAA1045 protein; ring finger domain, structural g 89.87
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 89.77
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 89.61
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 89.48
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 89.45
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 89.35
2k5c_A95 Uncharacterized protein PF0385; structural genomic 89.17
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 89.16
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 88.8
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 88.32
2czr_A226 TBP-interacting protein; tata-binding protein (TBP 88.3
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 88.23
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 87.78
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 86.51
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 86.27
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 85.79
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 85.79
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 84.94
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 84.39
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 83.91
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.72
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 83.62
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 82.48
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 81.3
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 80.96
1s24_A87 Rubredoxin 2; electron transport; NMR {Pseudomonas 80.78
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 80.62
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.96  E-value=5.3e-30  Score=166.79  Aligned_cols=107  Identities=32%  Similarity=0.612  Sum_probs=75.0

Q ss_pred             ccccCCCCccccCCCCCCccc-----------CCCCcceeeCCCCCccCChHHHHHHHHHhcCCCceeccccCccccCch
Q psy3507          28 LLVPTAEELMYHCKTCSTVSH-----------PNISYKYTCYACDYHTLMSEDMKKHMRKHTGEKPYKCEYCAYSCTQSS   96 (134)
Q Consensus        28 h~~~h~~~~~~~C~~C~~~f~-----------~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~   96 (134)
                      |++.|.++++|.|++|++.|.           +.++.+|.|+.|++.|.+...|..|+++|.++++|.|++|++.|.+..
T Consensus        68 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  147 (190)
T 2i13_A           68 HQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSRED  147 (190)
T ss_dssp             HHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHH
T ss_pred             HHHhcCCCCCccCcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHH
Confidence            444444445555555555554           445566777777777777777777777777777777777777777777


Q ss_pred             hHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHHHhcC
Q psy3507          97 ALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSHG  134 (134)
Q Consensus        97 ~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~~~H~  134 (134)
                      .|..|+++|++++||.|+.|++.|.+...|..|+++|+
T Consensus       148 ~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~  185 (190)
T 2i13_A          148 NLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHT  185 (190)
T ss_dssp             HHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC-
T ss_pred             HHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcC
Confidence            77777777777777777777777777777777777764



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 134
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-11
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.004
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-09
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-09
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 7e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d2dmda329 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 { 5e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 9e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 3e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 5e-04
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger and SCAN domain-containing protein 16, ZSCAN16
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.1 bits (125), Expect = 4e-11
 Identities = 13/36 (36%), Positives = 18/36 (50%)

Query: 72  KHMRKHTGEKPYKCEYCAYSCTQSSALKIHERKHTG 107
           +   +    + YKC+ C  S + SS L  H R HTG
Sbjct: 2   RSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTG 37


>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.81
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.76
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.5
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.49
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.45
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.45
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.44
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.38
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.34
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.33
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.32
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.3
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.27
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.26
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.23
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.21
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.2
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.18
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.14
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.13
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.13
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.11
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.1
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.09
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.08
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.01
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.98
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.97
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.96
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.93
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.91
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.88
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.86
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.85
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.85
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.78
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.7
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.68
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.63
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.56
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.44
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.43
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.41
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.38
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.26
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.22
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.22
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.19
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.18
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.1
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.09
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.09
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.05
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.03
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.02
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.99
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.98
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.89
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.85
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.82
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.79
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.76
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.72
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.7
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.65
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.52
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.52
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.45
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.41
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.36
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.34
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.34
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.24
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.21
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.21
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.19
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.13
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.05
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.98
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.98
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.93
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.9
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.88
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.88
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.85
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.59
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.57
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.42
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.35
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.27
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.21
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.14
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.97
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.63
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.53
d1y0jb136 U-shaped transcription factor, different fingers { 95.46
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.34
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.24
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.2
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 95.18
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 95.11
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.09
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 94.69
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 94.52
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 94.22
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 94.03
d1y0jb136 U-shaped transcription factor, different fingers { 93.94
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.02
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.01
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 92.6
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.26
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.88
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 91.78
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 91.02
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 91.02
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 90.64
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 90.37
d2dkta174 RING finger and CHY zinc finger domain-containing 90.3
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 90.17
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 90.13
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 90.06
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 90.0
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.9
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 89.35
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 88.91
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 88.76
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 88.55
d1twfl_46 RBP12 subunit of RNA polymerase II {Baker's yeast 88.46
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 87.95
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 87.91
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 87.12
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 86.85
d1dx8a_70 Rubredoxin {Guillardia theta [TaxId: 55529]} 86.48
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 85.61
d1fu9a_36 U-shaped transcription factor, different fingers { 84.31
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 83.63
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 80.98
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81  E-value=5e-21  Score=98.71  Aligned_cols=53  Identities=30%  Similarity=0.563  Sum_probs=41.8

Q ss_pred             CCceeccccCccccCchhHHHHhhhcCCCCCeecCcChhhhcCHHHHHHHHHhc
Q psy3507          80 EKPYKCEYCAYSCTQSSALKIHERKHTGDKPYICQQCRDTFSSLYLFRNRLQSH  133 (134)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~F~~~~~l~~H~~~H  133 (134)
                      |+||.|+ ||+.|.....|..|+++|++++||.|..||++|...+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4678884 8888888888888887888888888888888888888888888776



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure