Diaphorina citri psyllid: psy3511

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MLAVQCKRWGEPRVLELTTVDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVKNIVRSSKS
cCEEEEccccccccEEEEECcccccccccEEEEEEEEEEcccccHEEccccccccccccccccccccEEEEEEcccccccccccEEEEccc
MLAVQCKRWGEPRVLELTTVDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVKNIVRSS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAVQCKRWGEPRVLELTTVDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHFKVKNIVRSSKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004024 [MF]alcohol dehydrogenase activity, zinc-dependentprobableGO:0016614, GO:0016616, GO:0004022, GO:0003824, GO:0003674, GO:0016491
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0046914 [MF]transition metal ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0006631 [BP]fatty acid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0009987, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016628 [MF]oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptorprobableGO:0003824, GO:0016627, GO:0003674, GO:0016491
GO:0003960 [MF]NADPH:quinone reductase activityprobableGO:0016655, GO:0003824, GO:0003674, GO:0016651, GO:0016491
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031967 [CC]organelle envelopeprobableGO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046164 [BP]alcohol catabolic processprobableGO:0044712, GO:1901575, GO:0008152, GO:0009056, GO:0044710, GO:0006066, GO:0071704, GO:0008150, GO:0044281, GO:0044282, GO:1901616, GO:1901615
GO:0050661 [MF]NADP bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0051287 [MF]NAD bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YB5, chain A
Confidence level:very confident
Coverage over the Query: 1-89
View the alignment between query and template
View the model in PyMOL