Psyllid ID: psy3511
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 91 | ||||||
| 326925553 | 328 | PREDICTED: quinone oxidoreductase-like [ | 0.989 | 0.274 | 0.489 | 9e-14 | |
| 405970265 | 868 | Quinone oxidoreductase [Crassostrea giga | 0.956 | 0.100 | 0.516 | 2e-13 | |
| 440736868 | 308 | alcohol dehydrogenase zinc-binding domai | 0.879 | 0.259 | 0.518 | 5e-13 | |
| 447916817 | 308 | alcohol dehydrogenase zinc-binding domai | 0.879 | 0.259 | 0.518 | 6e-13 | |
| 344279000 | 331 | PREDICTED: quinone oxidoreductase-like i | 0.879 | 0.241 | 0.512 | 1e-12 | |
| 344279002 | 297 | PREDICTED: quinone oxidoreductase-like i | 0.879 | 0.269 | 0.512 | 1e-12 | |
| 341901574 | 327 | hypothetical protein CAEBREN_12682 [Caen | 0.912 | 0.253 | 0.476 | 2e-12 | |
| 340375310 | 361 | PREDICTED: quinone oxidoreductase-like [ | 0.967 | 0.243 | 0.478 | 2e-12 | |
| 410452943 | 328 | quinone oxidoreductase [Bacillus batavie | 0.879 | 0.243 | 0.487 | 3e-12 | |
| 17507255 | 328 | Protein F39B2.3 [Caenorhabditis elegans] | 0.934 | 0.259 | 0.465 | 5e-12 |
| >gi|326925553|ref|XP_003208977.1| PREDICTED: quinone oxidoreductase-like [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
Score = 80.9 bits (198), Expect = 9e-14, Method: Composition-based stats.
Identities = 45/92 (48%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
Query: 1 MLAVQCKRWGEPRVLELTT-VDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLP 59
M AV+ +G P VL L V P P D +VL+KV A G+NPVETYIRSG Y LP LP
Sbjct: 7 MRAVRVFEFGGPEVLRLQADVPIPAP-KDSQVLIKVHACGVNPVETYIRSGNYARLPTLP 65
Query: 60 AILGTEVSGIVEEVGQGVKHFKVKNIVRSSKS 91
G++V+G++E VG+GV FK + V +S +
Sbjct: 66 YTPGSDVAGVIESVGEGVTAFKRGDRVFTSAT 97
|
Source: Meleagris gallopavo Species: Meleagris gallopavo Genus: Meleagris Family: Phasianidae Order: Galliformes Class: Aves Phylum: Chordata Superkingdom: Eukaryota |
| >gi|405970265|gb|EKC35186.1| Quinone oxidoreductase [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|440736868|ref|ZP_20916451.1| alcohol dehydrogenase zinc-binding domain protein [Pseudomonas fluorescens BRIP34879] gi|440382629|gb|ELQ19123.1| alcohol dehydrogenase zinc-binding domain protein [Pseudomonas fluorescens BRIP34879] | Back alignment and taxonomy information |
|---|
| >gi|447916817|ref|YP_007397385.1| alcohol dehydrogenase zinc-binding domain protein [Pseudomonas poae RE*1-1-14] gi|445200680|gb|AGE25889.1| alcohol dehydrogenase zinc-binding domain protein [Pseudomonas poae RE*1-1-14] | Back alignment and taxonomy information |
|---|
| >gi|344279000|ref|XP_003411279.1| PREDICTED: quinone oxidoreductase-like isoform 1 [Loxodonta africana] | Back alignment and taxonomy information |
|---|
| >gi|344279002|ref|XP_003411280.1| PREDICTED: quinone oxidoreductase-like isoform 2 [Loxodonta africana] | Back alignment and taxonomy information |
|---|
| >gi|341901574|gb|EGT57509.1| hypothetical protein CAEBREN_12682 [Caenorhabditis brenneri] | Back alignment and taxonomy information |
|---|
| >gi|340375310|ref|XP_003386179.1| PREDICTED: quinone oxidoreductase-like [Amphimedon queenslandica] | Back alignment and taxonomy information |
|---|
| >gi|410452943|ref|ZP_11306905.1| quinone oxidoreductase [Bacillus bataviensis LMG 21833] gi|409933688|gb|EKN70608.1| quinone oxidoreductase [Bacillus bataviensis LMG 21833] | Back alignment and taxonomy information |
|---|
| >gi|17507255|ref|NP_493577.1| Protein F39B2.3 [Caenorhabditis elegans] gi|3876910|emb|CAB07384.1| Protein F39B2.3 [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 91 | ||||||
| RGD|1311639 | 329 | Cryz "crystallin, zeta (quinon | 0.879 | 0.243 | 0.5 | 5.6e-14 | |
| UNIPROTKB|P11415 | 329 | CRYZ "Quinone oxidoreductase" | 0.879 | 0.243 | 0.5 | 7.2e-14 | |
| WB|WBGene00009554 | 328 | F39B2.3 [Caenorhabditis elegan | 0.879 | 0.243 | 0.481 | 1.6e-13 | |
| ZFIN|ZDB-GENE-050306-24 | 328 | cryz "crystallin, zeta (quinon | 0.835 | 0.231 | 0.5 | 2.6e-13 | |
| UNIPROTKB|A6NP24 | 243 | CRYZ "Quinone oxidoreductase" | 0.989 | 0.370 | 0.445 | 2.7e-13 | |
| UNIPROTKB|C9JH92 | 206 | CRYZ "Quinone oxidoreductase" | 0.989 | 0.436 | 0.445 | 2.7e-13 | |
| UNIPROTKB|F1P4I0 | 331 | CRYZ "Uncharacterized protein" | 0.879 | 0.241 | 0.5 | 2.7e-13 | |
| UNIPROTKB|E2R3I8 | 336 | CRYZ "Uncharacterized protein" | 0.879 | 0.238 | 0.487 | 2.9e-13 | |
| UNIPROTKB|A6NN60 | 295 | CRYZ "Quinone oxidoreductase" | 0.989 | 0.305 | 0.445 | 4.8e-13 | |
| UNIPROTKB|Q08257 | 329 | CRYZ "Quinone oxidoreductase" | 0.989 | 0.273 | 0.445 | 7.5e-13 |
| RGD|1311639 Cryz "crystallin, zeta (quinone reductase)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 184 (69.8 bits), Expect = 5.6e-14, P = 5.6e-14
Identities = 41/82 (50%), Positives = 53/82 (64%)
Query: 1 MLAVQCKRWGEPRVLELTT-VDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLP 59
M A++ +G P VL+L + V P P +VL+KV A G+NPVETYIRSG Y P LP
Sbjct: 8 MRAIRVFEFGGPEVLKLQSDVVVPAP-QSHQVLIKVHACGVNPVETYIRSGTYSRKPALP 66
Query: 60 AILGTEVSGIVEEVGQGVKHFK 81
G++V+GI+E VG GV FK
Sbjct: 67 YTPGSDVAGIIESVGDGVSAFK 88
|
|
| UNIPROTKB|P11415 CRYZ "Quinone oxidoreductase" [Cavia porcellus (taxid:10141)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009554 F39B2.3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050306-24 cryz "crystallin, zeta (quinone reductase)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6NP24 CRYZ "Quinone oxidoreductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JH92 CRYZ "Quinone oxidoreductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4I0 CRYZ "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R3I8 CRYZ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6NN60 CRYZ "Quinone oxidoreductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08257 CRYZ "Quinone oxidoreductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 91 | |||
| cd08272 | 326 | cd08272, MDR6, Medium chain dehydrogenases/reducta | 4e-28 | |
| COG0604 | 326 | COG0604, Qor, NADPH:quinone reductase and related | 5e-25 | |
| cd05289 | 309 | cd05289, MDR_like_2, alcohol dehydrogenase and qui | 1e-24 | |
| cd08241 | 323 | cd08241, QOR1, Quinone oxidoreductase (QOR) | 8e-24 | |
| cd08253 | 325 | cd08253, zeta_crystallin, Zeta-crystallin with NAD | 3e-23 | |
| cd05286 | 320 | cd05286, QOR2, Quinone oxidoreductase (QOR) | 3e-23 | |
| cd05276 | 323 | cd05276, p53_inducible_oxidoreductase, PIG3 p53-in | 7e-21 | |
| cd08268 | 328 | cd08268, MDR2, Medium chain dehydrogenases/reducta | 2e-20 | |
| cd08267 | 319 | cd08267, MDR1, Medium chain dehydrogenases/reducta | 1e-19 | |
| cd08275 | 337 | cd08275, MDR3, Medium chain dehydrogenases/reducta | 4e-18 | |
| cd08249 | 339 | cd08249, enoyl_reductase_like, enoyl_reductase_lik | 9e-18 | |
| TIGR02824 | 325 | TIGR02824, quinone_pig3, putative NAD(P)H quinone | 1e-17 | |
| cd08266 | 342 | cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t | 2e-17 | |
| PRK10754 | 327 | PRK10754, PRK10754, quinone oxidoreductase, NADPH- | 2e-17 | |
| PTZ00354 | 334 | PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi | 3e-17 | |
| cd05188 | 271 | cd05188, MDR, Medium chain reductase/dehydrogenase | 1e-16 | |
| cd08248 | 350 | cd08248, RTN4I1, Human Reticulon 4 Interacting Pro | 2e-15 | |
| cd05284 | 340 | cd05284, arabinose_DH_like, D-arabinose dehydrogen | 5e-15 | |
| pfam08240 | 108 | pfam08240, ADH_N, Alcohol dehydrogenase GroES-like | 9e-15 | |
| cd08252 | 336 | cd08252, AL_MDR, Arginate lyase and other MDR fami | 1e-14 | |
| cd08244 | 324 | cd08244, MDR_enoyl_red, Possible enoyl reductase | 2e-14 | |
| COG1062 | 366 | COG1062, AdhC, Zn-dependent alcohol dehydrogenases | 2e-14 | |
| cd08234 | 334 | cd08234, threonine_DH_like, L-threonine dehydrogen | 3e-14 | |
| cd05282 | 323 | cd05282, ETR_like, 2-enoyl thioester reductase-lik | 3e-14 | |
| cd08279 | 363 | cd08279, Zn_ADH_class_III, Class III alcohol dehyd | 9e-14 | |
| cd08261 | 337 | cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD | 1e-13 | |
| cd08276 | 336 | cd08276, MDR7, Medium chain dehydrogenases/reducta | 3e-13 | |
| cd08259 | 332 | cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD | 3e-13 | |
| cd05279 | 365 | cd05279, Zn_ADH1, Liver alcohol dehydrogenase and | 3e-13 | |
| cd08290 | 341 | cd08290, ETR, 2-enoyl thioester reductase (ETR) | 6e-13 | |
| cd08236 | 343 | cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog | 1e-12 | |
| cd08264 | 325 | cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t | 2e-12 | |
| cd08292 | 324 | cd08292, ETR_like_2, 2-enoyl thioester reductase ( | 2e-12 | |
| cd08278 | 365 | cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro | 2e-12 | |
| cd08271 | 325 | cd08271, MDR5, Medium chain dehydrogenases/reducta | 4e-12 | |
| COG1064 | 339 | COG1064, AdhP, Zn-dependent alcohol dehydrogenases | 6e-12 | |
| cd08296 | 333 | cd08296, CAD_like, Cinnamyl alcohol dehydrogenases | 3e-11 | |
| cd08235 | 343 | cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas | 3e-11 | |
| cd08277 | 365 | cd08277, liver_alcohol_DH_like, Liver alcohol dehy | 5e-11 | |
| cd08246 | 393 | cd08246, crotonyl_coA_red, crotonyl-CoA reductase | 8e-11 | |
| cd08260 | 345 | cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD | 1e-10 | |
| cd05195 | 293 | cd05195, enoyl_red, enoyl reductase of polyketide | 1e-10 | |
| cd08297 | 341 | cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA | 2e-10 | |
| PRK13771 | 334 | PRK13771, PRK13771, putative alcohol dehydrogenase | 3e-10 | |
| TIGR01751 | 398 | TIGR01751, crot-CoA-red, crotonyl-CoA reductase | 5e-10 | |
| cd08291 | 324 | cd08291, ETR_like_1, 2-enoyl thioester reductase ( | 5e-10 | |
| cd08298 | 329 | cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA | 5e-10 | |
| cd08254 | 338 | cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e | 9e-10 | |
| cd08243 | 320 | cd08243, quinone_oxidoreductase_like_1, Quinone ox | 4e-09 | |
| cd08273 | 331 | cd08273, MDR8, Medium chain dehydrogenases/reducta | 4e-09 | |
| cd08265 | 384 | cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD | 6e-09 | |
| TIGR02817 | 336 | TIGR02817, adh_fam_1, zinc-binding alcohol dehydro | 7e-09 | |
| TIGR03989 | 369 | TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa | 1e-08 | |
| cd08300 | 368 | cd08300, alcohol_DH_class_III, class III alcohol d | 1e-08 | |
| smart00829 | 287 | smart00829, PKS_ER, Enoylreductase | 1e-08 | |
| cd08233 | 351 | cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio | 1e-08 | |
| cd08258 | 306 | cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD | 3e-08 | |
| cd08274 | 350 | cd08274, MDR9, Medium chain dehydrogenases/reducta | 4e-08 | |
| cd08281 | 371 | cd08281, liver_ADH_like1, Zinc-dependent alcohol d | 4e-08 | |
| cd08299 | 373 | cd08299, alcohol_DH_class_I_II_IV, class I, II, IV | 8e-08 | |
| cd08250 | 329 | cd08250, Mgc45594_like, Mgc45594 gene product and | 2e-07 | |
| cd08245 | 330 | cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD | 3e-07 | |
| TIGR02818 | 368 | TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat | 3e-07 | |
| cd05278 | 347 | cd05278, FDH_like, Formaldehyde dehydrogenases | 3e-07 | |
| cd08301 | 369 | cd08301, alcohol_DH_plants, Plant alcohol dehydrog | 3e-07 | |
| cd08251 | 303 | cd08251, polyketide_synthase, polyketide synthase | 3e-07 | |
| cd08263 | 367 | cd08263, Zn_ADH10, Alcohol dehydrogenases of the M | 4e-07 | |
| cd08283 | 386 | cd08283, FDH_like_1, Glutathione-dependent formald | 4e-07 | |
| cd05281 | 341 | cd05281, TDH, Threonine dehydrogenase | 5e-07 | |
| TIGR03451 | 358 | TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi | 5e-07 | |
| PRK05396 | 341 | PRK05396, tdh, L-threonine 3-dehydrogenase; Valida | 8e-07 | |
| cd05285 | 343 | cd05285, sorbitol_DH, Sorbitol dehydrogenase | 8e-07 | |
| cd08247 | 352 | cd08247, AST1_like, AST1 is a cytoplasmic protein | 2e-06 | |
| cd08242 | 319 | cd08242, MDR_like, Medium chain dehydrogenases/red | 2e-06 | |
| cd08240 | 350 | cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa | 3e-06 | |
| COG1063 | 350 | COG1063, Tdh, Threonine dehydrogenase and related | 6e-06 | |
| PLN02827 | 378 | PLN02827, PLN02827, Alcohol dehydrogenase-like | 7e-06 | |
| cd08284 | 344 | cd08284, FDH_like_2, Glutathione-dependent formald | 1e-05 | |
| PLN02740 | 381 | PLN02740, PLN02740, Alcohol dehydrogenase-like | 1e-05 | |
| cd08282 | 375 | cd08282, PFDH_like, Pseudomonas putida aldehyde-di | 1e-05 | |
| TIGR00692 | 340 | TIGR00692, tdh, L-threonine 3-dehydrogenase | 2e-05 | |
| cd08239 | 339 | cd08239, THR_DH_like, L-threonine dehydrogenase (T | 5e-05 | |
| cd05283 | 337 | cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA | 1e-04 | |
| cd08231 | 361 | cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 | 2e-04 | |
| cd08232 | 339 | cd08232, idonate-5-DH, L-idonate 5-dehydrogenase | 6e-04 | |
| cd05280 | 325 | cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ | 7e-04 | |
| cd08269 | 312 | cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD | 8e-04 | |
| cd08286 | 345 | cd08286, FDH_like_ADH2, formaldehyde dehydrogenase | 9e-04 | |
| PLN02514 | 357 | PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase | 0.001 | |
| cd08285 | 351 | cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd | 0.001 | |
| cd08238 | 410 | cd08238, sorbose_phosphate_red, L-sorbose-1-phosph | 0.003 | |
| PRK10083 | 339 | PRK10083, PRK10083, putative oxidoreductase; Provi | 0.003 | |
| cd08230 | 355 | cd08230, glucose_DH, Glucose dehydrogenase | 0.003 |
| >gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
Score = 102 bits (257), Expect = 4e-28
Identities = 39/82 (47%), Positives = 54/82 (65%), Gaps = 1/82 (1%)
Query: 1 MLAVQCKRWGEPRVLELTTVDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLPA 60
M A+ + +G P V EL V +P P +VLV+V A+G+NP++T IR G P LPA
Sbjct: 1 MKALVLESFGGPEVFELREVPRPQP-GPGQVLVRVHASGVNPLDTKIRRGGAAARPPLPA 59
Query: 61 ILGTEVSGIVEEVGQGVKHFKV 82
ILG +V+G+VE VG+GV F+V
Sbjct: 60 ILGCDVAGVVEAVGEGVTRFRV 81
|
This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 326 |
| >gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases | Back alignment and domain information |
|---|
| >gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like | Back alignment and domain information |
|---|
| >gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family | Back alignment and domain information |
|---|
| >gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase | Back alignment and domain information |
|---|
| >gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family | Back alignment and domain information |
|---|
| >gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase | Back alignment and domain information |
|---|
| >gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast | Back alignment and domain information |
|---|
| >gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >gnl|CDD|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) | Back alignment and domain information |
|---|
| >gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176200 cd08238, sorbose_phosphate_red, L-sorbose-1-phosphate reductase | Back alignment and domain information |
|---|
| >gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 99.92 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 99.89 | |
| COG1062 | 366 | AdhC Zn-dependent alcohol dehydrogenases, class II | 99.88 | |
| KOG0023|consensus | 360 | 99.87 | ||
| KOG1197|consensus | 336 | 99.84 | ||
| TIGR02819 | 393 | fdhA_non_GSH formaldehyde dehydrogenase, glutathio | 99.83 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 99.83 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 99.83 | |
| KOG0022|consensus | 375 | 99.83 | ||
| PF08240 | 109 | ADH_N: Alcohol dehydrogenase GroES-like domain; In | 99.82 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 99.82 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 99.82 | |
| cd08291 | 324 | ETR_like_1 2-enoyl thioester reductase (ETR) like | 99.81 | |
| KOG0024|consensus | 354 | 99.8 | ||
| TIGR02818 | 368 | adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr | 99.8 | |
| cd08301 | 369 | alcohol_DH_plants Plant alcohol dehydrogenase. NAD | 99.8 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 99.8 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 99.79 | |
| cd08300 | 368 | alcohol_DH_class_III class III alcohol dehydrogena | 99.78 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 99.78 | |
| PLN02827 | 378 | Alcohol dehydrogenase-like | 99.77 | |
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 99.77 | |
| cd08277 | 365 | liver_alcohol_DH_like Liver alcohol dehydrogenase. | 99.77 | |
| KOG0025|consensus | 354 | 99.76 | ||
| TIGR02822 | 329 | adh_fam_2 zinc-binding alcohol dehydrogenase famil | 99.75 | |
| cd08238 | 410 | sorbose_phosphate_red L-sorbose-1-phosphate reduct | 99.74 | |
| PLN02178 | 375 | cinnamyl-alcohol dehydrogenase | 99.74 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 99.74 | |
| cd08237 | 341 | ribitol-5-phosphate_DH ribitol-5-phosphate dehydro | 99.73 | |
| cd08233 | 351 | butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog | 99.73 | |
| cd08250 | 329 | Mgc45594_like Mgc45594 gene product and other MDR | 99.73 | |
| cd08290 | 341 | ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi | 99.72 | |
| PRK10083 | 339 | putative oxidoreductase; Provisional | 99.72 | |
| TIGR02817 | 336 | adh_fam_1 zinc-binding alcohol dehydrogenase famil | 99.71 | |
| cd05280 | 325 | MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone | 99.71 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 99.71 | |
| cd08296 | 333 | CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci | 99.7 | |
| cd08278 | 365 | benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be | 99.7 | |
| cd08231 | 361 | MDR_TM0436_like Hypothetical enzyme TM0436 resembl | 99.7 | |
| cd08276 | 336 | MDR7 Medium chain dehydrogenases/reductase (MDR)/z | 99.7 | |
| cd05284 | 340 | arabinose_DH_like D-arabinose dehydrogenase. This | 99.7 | |
| PTZ00354 | 334 | alcohol dehydrogenase; Provisional | 99.7 | |
| cd08285 | 351 | NADP_ADH NADP(H)-dependent alcohol dehydrogenases. | 99.7 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 99.7 | |
| cd08283 | 386 | FDH_like_1 Glutathione-dependent formaldehyde dehy | 99.69 | |
| PRK10754 | 327 | quinone oxidoreductase, NADPH-dependent; Provision | 99.69 | |
| cd08240 | 350 | 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy | 99.69 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 99.69 | |
| cd08274 | 350 | MDR9 Medium chain dehydrogenases/reductase (MDR)/z | 99.69 | |
| cd08273 | 331 | MDR8 Medium chain dehydrogenases/reductase (MDR)/z | 99.69 | |
| cd08297 | 341 | CAD3 Cinnamyl alcohol dehydrogenases (CAD). These | 99.69 | |
| cd08253 | 325 | zeta_crystallin Zeta-crystallin with NADP-dependen | 99.69 | |
| cd08266 | 342 | Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam | 99.68 | |
| cd05276 | 323 | p53_inducible_oxidoreductase PIG3 p53-inducible qu | 99.68 | |
| cd08279 | 363 | Zn_ADH_class_III Class III alcohol dehydrogenase. | 99.68 | |
| cd08272 | 326 | MDR6 Medium chain dehydrogenases/reductase (MDR)/z | 99.68 | |
| cd08282 | 375 | PFDH_like Pseudomonas putida aldehyde-dismutating | 99.68 | |
| cd05278 | 347 | FDH_like Formaldehyde dehydrogenases. Formaldehyde | 99.68 | |
| cd08244 | 324 | MDR_enoyl_red Possible enoyl reductase. Member ide | 99.68 | |
| PRK05396 | 341 | tdh L-threonine 3-dehydrogenase; Validated | 99.68 | |
| cd08299 | 373 | alcohol_DH_class_I_II_IV class I, II, IV alcohol d | 99.67 | |
| cd08256 | 350 | Zn_ADH2 Alcohol dehydrogenases of the MDR family. | 99.67 | |
| cd08259 | 332 | Zn_ADH5 Alcohol dehydrogenases of the MDR family. | 99.67 | |
| cd08234 | 334 | threonine_DH_like L-threonine dehydrogenase. L-thr | 99.67 | |
| cd08288 | 324 | MDR_yhdh Yhdh putative quinone oxidoreductases. Yh | 99.67 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 99.67 | |
| cd08270 | 305 | MDR4 Medium chain dehydrogenases/reductase (MDR)/z | 99.66 | |
| cd08249 | 339 | enoyl_reductase_like enoyl_reductase_like. Member | 99.66 | |
| cd08254 | 338 | hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo | 99.66 | |
| PRK09422 | 338 | ethanol-active dehydrogenase/acetaldehyde-active r | 99.66 | |
| cd08286 | 345 | FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik | 99.66 | |
| cd08258 | 306 | Zn_ADH4 Alcohol dehydrogenases of the MDR family. | 99.66 | |
| cd08263 | 367 | Zn_ADH10 Alcohol dehydrogenases of the MDR family. | 99.66 | |
| cd08248 | 350 | RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu | 99.66 | |
| cd08287 | 345 | FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik | 99.66 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 99.65 | |
| cd08260 | 345 | Zn_ADH6 Alcohol dehydrogenases of the MDR family. | 99.65 | |
| PRK13771 | 334 | putative alcohol dehydrogenase; Provisional | 99.65 | |
| cd08235 | 343 | iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ | 99.65 | |
| cd08264 | 325 | Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam | 99.65 | |
| cd08262 | 341 | Zn_ADH8 Alcohol dehydrogenases of the MDR family. | 99.65 | |
| cd08298 | 329 | CAD2 Cinnamyl alcohol dehydrogenases (CAD). These | 99.64 | |
| cd08252 | 336 | AL_MDR Arginate lyase and other MDR family members | 99.64 | |
| TIGR02823 | 323 | oxido_YhdH putative quinone oxidoreductase, YhdH/Y | 99.64 | |
| cd08236 | 343 | sugar_DH NAD(P)-dependent sugar dehydrogenases. Th | 99.64 | |
| cd08289 | 326 | MDR_yhfp_like Yhfp putative quinone oxidoreductase | 99.64 | |
| cd08261 | 337 | Zn_ADH7 Alcohol dehydrogenases of the MDR family. | 99.63 | |
| cd08268 | 328 | MDR2 Medium chain dehydrogenases/reductase (MDR)/z | 99.63 | |
| cd08284 | 344 | FDH_like_2 Glutathione-dependent formaldehyde dehy | 99.63 | |
| cd08271 | 325 | MDR5 Medium chain dehydrogenases/reductase (MDR)/z | 99.62 | |
| cd08242 | 319 | MDR_like Medium chain dehydrogenases/reductase (MD | 99.62 | |
| cd05283 | 337 | CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam | 99.62 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 99.61 | |
| cd05289 | 309 | MDR_like_2 alcohol dehydrogenase and quinone reduc | 99.61 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 99.61 | |
| cd05279 | 365 | Zn_ADH1 Liver alcohol dehydrogenase and related zi | 99.61 | |
| cd08247 | 352 | AST1_like AST1 is a cytoplasmic protein associated | 99.61 | |
| cd05281 | 341 | TDH Threonine dehydrogenase. L-threonine dehydroge | 99.59 | |
| TIGR02824 | 325 | quinone_pig3 putative NAD(P)H quinone oxidoreducta | 99.59 | |
| TIGR01751 | 398 | crot-CoA-red crotonyl-CoA reductase. The enzyme mo | 99.58 | |
| cd08243 | 320 | quinone_oxidoreductase_like_1 Quinone oxidoreducta | 99.58 | |
| cd05282 | 323 | ETR_like 2-enoyl thioester reductase-like. 2-enoyl | 99.58 | |
| cd08275 | 337 | MDR3 Medium chain dehydrogenases/reductase (MDR)/z | 99.57 | |
| PLN02702 | 364 | L-idonate 5-dehydrogenase | 99.57 | |
| cd08246 | 393 | crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- | 99.57 | |
| cd08245 | 330 | CAD Cinnamyl alcohol dehydrogenases (CAD) and rela | 99.56 | |
| cd08241 | 323 | QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t | 99.54 | |
| TIGR00692 | 340 | tdh L-threonine 3-dehydrogenase. E. coli His-90 mo | 99.54 | |
| cd05286 | 320 | QOR2 Quinone oxidoreductase (QOR). Quinone oxidore | 99.53 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 99.52 | |
| cd08232 | 339 | idonate-5-DH L-idonate 5-dehydrogenase. L-idonate | 99.52 | |
| cd08265 | 384 | Zn_ADH3 Alcohol dehydrogenases of the MDR family. | 99.51 | |
| cd08269 | 312 | Zn_ADH9 Alcohol dehydrogenases of the MDR family. | 99.5 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 99.49 | |
| cd08267 | 319 | MDR1 Medium chain dehydrogenases/reductase (MDR)/z | 99.46 | |
| cd05285 | 343 | sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a | 99.46 | |
| cd05288 | 329 | PGDH Prostaglandin dehydrogenases. Prostaglandins | 99.44 | |
| cd08251 | 303 | polyketide_synthase polyketide synthase. Polyketid | 99.38 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 99.28 | |
| COG2130 | 340 | Putative NADP-dependent oxidoreductases [General f | 99.16 | |
| cd05195 | 293 | enoyl_red enoyl reductase of polyketide synthase. | 99.13 | |
| smart00829 | 288 | PKS_ER Enoylreductase. Enoylreductase in Polyketid | 98.85 | |
| KOG1198|consensus | 347 | 98.78 | ||
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 98.35 | |
| KOG1196|consensus | 343 | 98.1 | ||
| cd08255 | 277 | 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ | 98.07 | |
| PF13823 | 23 | ADH_N_assoc: Alcohol dehydrogenase GroES-associate | 95.05 | |
| KOG1202|consensus | 2376 | 94.72 | ||
| cd00320 | 93 | cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); C | 93.87 | |
| PTZ00414 | 100 | 10 kDa heat shock protein; Provisional | 93.17 | |
| PRK00364 | 95 | groES co-chaperonin GroES; Reviewed | 92.62 | |
| PRK14533 | 91 | groES co-chaperonin GroES; Provisional | 91.21 | |
| COG0234 | 96 | GroS Co-chaperonin GroES (HSP10) [Posttranslationa | 90.2 | |
| PF00166 | 93 | Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR0208 | 89.84 | |
| KOG1641|consensus | 104 | 83.65 |
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.92 E-value=2.9e-24 Score=141.07 Aligned_cols=84 Identities=39% Similarity=0.583 Sum_probs=79.6
Q ss_pred CeEEEEcccCCCCceEEEEecCCCCCCCCeEEEEEeEEecChhHHHHHhCCCCCCCCCCcccccceEEEEEEeCCCCCCC
Q psy3511 1 MLAVQCKRWGEPRVLELTTVDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHF 80 (91)
Q Consensus 1 m~a~~~~~~~~~~~~~~~~~~~p~~~~~~ev~v~v~~~~l~~~d~~~~~g~~~~~~~~p~~~g~e~~G~V~~vG~~~~~~ 80 (91)
|||+++.+++++ +++.+.+.|+ |+++||+|+|+|+|+|++|++..+|.++.. .+|.++|||.+|+|+++|++|++|
T Consensus 4 mkA~~~~~~~~p--l~i~e~~~p~-p~~~eVlI~v~~~GVChsDlH~~~G~~~~~-~~P~ipGHEivG~V~~vG~~V~~~ 79 (339)
T COG1064 4 MKAAVLKKFGQP--LEIEEVPVPE-PGPGEVLIKVEACGVCHTDLHVAKGDWPVP-KLPLIPGHEIVGTVVEVGEGVTGL 79 (339)
T ss_pred eEEEEEccCCCC--ceEEeccCCC-CCCCeEEEEEEEEeecchhhhhhcCCCCCC-CCCccCCcceEEEEEEecCCCccC
Confidence 899999998888 9999999999 999999999999999999999999999754 499999999999999999999999
Q ss_pred CCCCEEEe
Q psy3511 81 KVKNIVRS 88 (91)
Q Consensus 81 ~~Gd~V~~ 88 (91)
++||||..
T Consensus 80 k~GDrVgV 87 (339)
T COG1064 80 KVGDRVGV 87 (339)
T ss_pred CCCCEEEe
Confidence 99999976
|
|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0023|consensus | Back alignment and domain information |
|---|
| >KOG1197|consensus | Back alignment and domain information |
|---|
| >TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >KOG0022|consensus | Back alignment and domain information |
|---|
| >PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 | Back alignment and domain information |
|---|
| >KOG0024|consensus | Back alignment and domain information |
|---|
| >TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08301 alcohol_DH_plants Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >cd08300 alcohol_DH_class_III class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02827 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >KOG0025|consensus | Back alignment and domain information |
|---|
| >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase | Back alignment and domain information |
|---|
| >PLN02178 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >cd08290 ETR 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >PRK10083 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05284 arabinose_DH_like D-arabinose dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00354 alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 | Back alignment and domain information |
|---|
| >PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional | Back alignment and domain information |
|---|
| >cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) | Back alignment and domain information |
|---|
| >cd05278 FDH_like Formaldehyde dehydrogenases | Back alignment and domain information |
|---|
| >cd08244 MDR_enoyl_red Possible enoyl reductase | Back alignment and domain information |
|---|
| >PRK05396 tdh L-threonine 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08234 threonine_DH_like L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08249 enoyl_reductase_like enoyl_reductase_like | Back alignment and domain information |
|---|
| >cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional | Back alignment and domain information |
|---|
| >cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 | Back alignment and domain information |
|---|
| >cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK13771 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase | Back alignment and domain information |
|---|
| >cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08252 AL_MDR Arginate lyase and other MDR family members | Back alignment and domain information |
|---|
| >TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family | Back alignment and domain information |
|---|
| >cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases | Back alignment and domain information |
|---|
| >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast | Back alignment and domain information |
|---|
| >cd05281 TDH Threonine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family | Back alignment and domain information |
|---|
| >TIGR01751 crot-CoA-red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd05282 ETR_like 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PLN02702 L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd08246 crotonyl_coA_red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins | Back alignment and domain information |
|---|
| >cd08241 QOR1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >TIGR00692 tdh L-threonine 3-dehydrogenase | Back alignment and domain information |
|---|
| >cd05286 QOR2 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08232 idonate-5-DH L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05285 sorbitol_DH Sorbitol dehydrogenase | Back alignment and domain information |
|---|
| >cd05288 PGDH Prostaglandin dehydrogenases | Back alignment and domain information |
|---|
| >cd08251 polyketide_synthase polyketide synthase | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >cd05195 enoyl_red enoyl reductase of polyketide synthase | Back alignment and domain information |
|---|
| >smart00829 PKS_ER Enoylreductase | Back alignment and domain information |
|---|
| >KOG1198|consensus | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >KOG1196|consensus | Back alignment and domain information |
|---|
| >cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members | Back alignment and domain information |
|---|
| >PF13823 ADH_N_assoc: Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B | Back alignment and domain information |
|---|
| >KOG1202|consensus | Back alignment and domain information |
|---|
| >cd00320 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts | Back alignment and domain information |
|---|
| >PTZ00414 10 kDa heat shock protein; Provisional | Back alignment and domain information |
|---|
| >PRK00364 groES co-chaperonin GroES; Reviewed | Back alignment and domain information |
|---|
| >PRK14533 groES co-chaperonin GroES; Provisional | Back alignment and domain information |
|---|
| >COG0234 GroS Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00166 Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR020818 The chaperonins are `helper' molecules required for correct folding and subsequent assembly of some proteins [] | Back alignment and domain information |
|---|
| >KOG1641|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 91 | ||||
| 1yb5_A | 351 | Crystal Structure Of Human Zeta-crystallin With Bou | 2e-13 | ||
| 1qor_A | 327 | Crystal Structure Of Escherichia Coli Quinone Oxido | 3e-12 | ||
| 3jyl_A | 325 | Crystal Structures Of Pseudomonas Syringae Pv. Toma | 3e-09 | ||
| 2j8z_A | 354 | Crystal Structure Of Human P53 Inducible Oxidoreduc | 3e-08 | ||
| 2oby_A | 338 | Crystal Structure Of Human P53 Inducible Oxidoreduc | 4e-08 | ||
| 3pii_A | 339 | Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog | 2e-07 | ||
| 1rjw_A | 339 | Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd | 2e-07 | ||
| 2eih_A | 343 | Crystal Structure Of Nad-Dependent Alcohol Dehydrog | 2e-07 | ||
| 3gaz_A | 343 | Crystal Structure Of An Alcohol Dehydrogenase Super | 2e-07 | ||
| 3qwa_A | 334 | Crystal Structure Of Saccharomyces Cerevisiae Zeta- | 1e-06 | ||
| 1f8f_A | 371 | Crystal Structure Of Benzyl Alcohol Dehydrogenase F | 3e-06 | ||
| 3i4c_A | 347 | Crystal Structure Of Sulfolobus Solfataricus Adh(Ss | 5e-06 | ||
| 1r37_A | 347 | Alcohol Dehydrogenase From Sulfolobus Solfataricus | 6e-06 | ||
| 1nto_A | 347 | N249y Mutant Of Alcohol Dehydrogenase From The Arch | 6e-06 | ||
| 3meq_A | 365 | Crystal Structure Of Alcohol Dehydrogenase From Bru | 6e-06 | ||
| 4a27_A | 349 | Crystal Structure Of Human Synaptic Vesicle Membran | 7e-06 | ||
| 3tqh_A | 321 | Structure Of The Quinone Oxidoreductase From Coxiel | 2e-05 | ||
| 3s1l_A | 340 | Crystal Structure Of Apo-Form Furx Length = 340 | 3e-05 | ||
| 1llu_A | 342 | The Ternary Complex Of Pseudomonas Aeruginosa Alcoh | 3e-05 | ||
| 2vn8_A | 375 | Crystal Structure Of Human Reticulon 4 Interacting | 3e-05 | ||
| 1jvb_A | 347 | Alcohol Dehydrogenase From The Archaeon Sulfolobus | 3e-05 | ||
| 2eer_A | 347 | Structural Study Of Project Id St2577 From Sulfolob | 4e-05 | ||
| 4ej6_A | 370 | Crystal Structure Of A Putative Zinc-Binding Dehydr | 8e-05 | ||
| 3two_A | 348 | The Crystal Structure Of Cad From Helicobacter Pylo | 9e-05 | ||
| 4dup_A | 353 | Crystal Structure Of A Quinone Oxidoreductase From | 1e-04 | ||
| 3qj5_A | 374 | S-Nitrosoglutathione Reductase (Gsnor) In Complex W | 2e-04 | ||
| 1teh_A | 373 | Structure Of Human Liver Chichi Alcohol Dehydrogena | 2e-04 | ||
| 1mc5_A | 374 | Ternary Complex Of Human Glutathione-Dependent Form | 2e-04 | ||
| 1ht0_A | 374 | Human Gamma-2 Alcohol Dehydrogense Length = 374 | 2e-04 | ||
| 1e3e_A | 376 | Mouse Class Ii Alcohol Dehydrogenase Complex With N | 2e-04 | ||
| 3gms_A | 340 | Crystal Structure Of Putative Nadph:quinone Reducta | 3e-04 | ||
| 3fbg_A | 346 | Crystal Structure Of A Putative Arginate Lyase From | 3e-04 | ||
| 1wly_A | 333 | Crystal Structure Of 2-haloacrylate Reductase Lengt | 4e-04 | ||
| 1hdy_A | 374 | Three-Dimensional Structures Of Three Human Alcohol | 4e-04 | ||
| 1cdo_A | 374 | Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Co | 5e-04 | ||
| 1htb_A | 374 | Crystallization Of Human Beta3 Alcohol Dehydrogenas | 5e-04 | ||
| 1hdz_A | 374 | Three-Dimensional Structures Of Three Human Alcohol | 5e-04 | ||
| 1hdx_A | 374 | Three-Dimensional Structures Of Three Human Alcohol | 5e-04 | ||
| 2xaa_A | 345 | Alcohol Dehydrogenase Adh-'a' From Rhodococcus Rube | 5e-04 | ||
| 1hso_A | 374 | Human Alpha Alcohol Dehydrogenase (Adh1a) Length = | 6e-04 | ||
| 3slk_A | 795 | Structure Of Ketoreductase And Enoylreductase Didom | 9e-04 |
| >pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 | Back alignment and structure |
|
| >pdb|1QOR|A Chain A, Crystal Structure Of Escherichia Coli Quinone Oxidoreductase Complexed With Nadph Length = 327 | Back alignment and structure |
| >pdb|3JYL|A Chain A, Crystal Structures Of Pseudomonas Syringae Pv. Tomato Dc3000 Quinone Oxidoreductase Length = 325 | Back alignment and structure |
| >pdb|2J8Z|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase ( Tp53i3,Pig3) Length = 354 | Back alignment and structure |
| >pdb|2OBY|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase (Tp53i3,Pig3) Length = 338 | Back alignment and structure |
| >pdb|3PII|A Chain A, Crystal Structure Of Mutant Of Ht- Alcohol Dehydrogenase With Substrate Analogue Butyramide Length = 339 | Back alignment and structure |
| >pdb|1RJW|A Chain A, Crystal Structure Of Nad(+)-Dependent Alcohol Dehydrogenase From Bacillus Stearothermophilus Strain Lld-R Length = 339 | Back alignment and structure |
| >pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 | Back alignment and structure |
| >pdb|3GAZ|A Chain A, Crystal Structure Of An Alcohol Dehydrogenase Superfamily Protein From Novosphingobium Aromaticivorans Length = 343 | Back alignment and structure |
| >pdb|3QWA|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Zeta-Crystallin-Like Quinone Oxidoreductase Zta1 Length = 334 | Back alignment and structure |
| >pdb|1F8F|A Chain A, Crystal Structure Of Benzyl Alcohol Dehydrogenase From Acinetobacter Calcoaceticus Length = 371 | Back alignment and structure |
| >pdb|3I4C|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Adh(Ssadh) Double Mutant (W95l,N249y) Length = 347 | Back alignment and structure |
| >pdb|1R37|A Chain A, Alcohol Dehydrogenase From Sulfolobus Solfataricus Complexed With Nad(H) And 2-Ethoxyethanol Length = 347 | Back alignment and structure |
| >pdb|1NTO|A Chain A, N249y Mutant Of Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus-Monoclinic Crystal Form Length = 347 | Back alignment and structure |
| >pdb|3MEQ|A Chain A, Crystal Structure Of Alcohol Dehydrogenase From Brucella Mel Length = 365 | Back alignment and structure |
| >pdb|4A27|A Chain A, Crystal Structure Of Human Synaptic Vesicle Membrane Protein Vat-1 Homolog-Like Protein Length = 349 | Back alignment and structure |
| >pdb|3TQH|A Chain A, Structure Of The Quinone Oxidoreductase From Coxiella Burnetii Length = 321 | Back alignment and structure |
| >pdb|3S1L|A Chain A, Crystal Structure Of Apo-Form Furx Length = 340 | Back alignment and structure |
| >pdb|1LLU|A Chain A, The Ternary Complex Of Pseudomonas Aeruginosa Alcohol Dehydrogenase With Its Coenzyme And Weak Substrate Length = 342 | Back alignment and structure |
| >pdb|2VN8|A Chain A, Crystal Structure Of Human Reticulon 4 Interacting Protein 1 In Complex With Nadph Length = 375 | Back alignment and structure |
| >pdb|1JVB|A Chain A, Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus Length = 347 | Back alignment and structure |
| >pdb|2EER|A Chain A, Structural Study Of Project Id St2577 From Sulfolobus Tokodaii Strain7 Length = 347 | Back alignment and structure |
| >pdb|4EJ6|A Chain A, Crystal Structure Of A Putative Zinc-Binding Dehydrogenase (Target Psi-012003) From Sinorhizobium Meliloti 1021 Length = 370 | Back alignment and structure |
| >pdb|3TWO|A Chain A, The Crystal Structure Of Cad From Helicobacter Pylori Complexed With Nadp(H) Length = 348 | Back alignment and structure |
| >pdb|4DUP|A Chain A, Crystal Structure Of A Quinone Oxidoreductase From Rhizobium Etli Cfn 42 Length = 353 | Back alignment and structure |
| >pdb|3QJ5|A Chain A, S-Nitrosoglutathione Reductase (Gsnor) In Complex With N6022 Length = 374 | Back alignment and structure |
| >pdb|1TEH|A Chain A, Structure Of Human Liver Chichi Alcohol Dehydrogenase (A Glutathione- Dependent Formaldehyde Dehydrogenase) Length = 373 | Back alignment and structure |
| >pdb|1MC5|A Chain A, Ternary Complex Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With S-(Hydroxymethyl)glutathione And Nadh Length = 374 | Back alignment and structure |
| >pdb|1HT0|A Chain A, Human Gamma-2 Alcohol Dehydrogense Length = 374 | Back alignment and structure |
| >pdb|1E3E|A Chain A, Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 | Back alignment and structure |
| >pdb|3GMS|A Chain A, Crystal Structure Of Putative Nadph:quinone Reductase From Bacillus Thuringiensis Length = 340 | Back alignment and structure |
| >pdb|3FBG|A Chain A, Crystal Structure Of A Putative Arginate Lyase From Staphylococcus Haemolyticus Length = 346 | Back alignment and structure |
| >pdb|1WLY|A Chain A, Crystal Structure Of 2-haloacrylate Reductase Length = 333 | Back alignment and structure |
| >pdb|1HDY|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 | Back alignment and structure |
| >pdb|1CDO|A Chain A, Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Complexed With Nicotinamide Adenine Dinucleotide (Nad), And Zinc Length = 374 | Back alignment and structure |
| >pdb|1HTB|A Chain A, Crystallization Of Human Beta3 Alcohol Dehydrogenase (10 MgML) IN 100 MM SODIUM PHOSPHATE (PH 7.5), 7.5 MM NAD+ And 1 Mm 4-Iodopyrazole At 25 C Length = 374 | Back alignment and structure |
| >pdb|1HDZ|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 | Back alignment and structure |
| >pdb|1HDX|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 | Back alignment and structure |
| >pdb|2XAA|A Chain A, Alcohol Dehydrogenase Adh-'a' From Rhodococcus Ruber Dsm 44541 At Ph 8.5 In Complex With Nad And Butane-1,4-Diol Length = 345 | Back alignment and structure |
| >pdb|1HSO|A Chain A, Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 374 | Back alignment and structure |
| >pdb|3SLK|A Chain A, Structure Of Ketoreductase And Enoylreductase Didomain From Modular Polyketide Synthase Length = 795 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 91 | |||
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 1e-29 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 1e-29 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 3e-29 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 6e-29 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 5e-28 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 5e-28 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 1e-27 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 2e-27 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 2e-27 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 5e-27 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 3e-26 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 3e-26 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 4e-25 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 8e-25 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 1e-24 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 3e-24 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 4e-24 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 5e-24 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 2e-23 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 2e-22 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 5e-21 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 6e-20 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 4e-18 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 8e-18 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 1e-16 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 2e-16 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 5e-16 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 2e-15 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 2e-15 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 2e-15 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 2e-15 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 1e-14 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 3e-14 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 3e-14 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 4e-14 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 7e-14 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 4e-13 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 5e-13 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 4e-12 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 2e-11 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 3e-11 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 3e-11 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 4e-11 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 5e-11 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 7e-11 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 1e-10 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 1e-10 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 3e-10 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 7e-10 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 8e-10 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 8e-09 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 9e-09 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 5e-05 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 5e-05 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 5e-05 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 9e-05 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 1e-04 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 1e-04 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 6e-04 |
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 | Back alignment and structure |
|---|
Score = 106 bits (268), Expect = 1e-29
Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
Query: 1 MLAVQCKRWGEPR-VLELTTVDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLP 59
+Q ++G P+ VL++ + D+EV V+++ INP + +G Y + LP
Sbjct: 5 GKLIQFHKFGNPKDVLQVEYKNIEPL-KDNEVFVRMLVRPINPSDLIPITGAYAHRIPLP 63
Query: 60 AILGTEVSGIVEEVGQGVKHFKV 82
I G E GIVE VG V +
Sbjct: 64 NIPGYEGVGIVENVGAFVSRELI 86
|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 | Back alignment and structure |
|---|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 99.91 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 99.91 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 99.91 | |
| 4eez_A | 348 | Alcohol dehydrogenase 1; site-saturation mutagenes | 99.91 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 99.91 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 99.91 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 99.9 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 99.9 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 99.9 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 99.9 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 99.9 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 99.9 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 99.9 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 99.9 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 99.9 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 99.9 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 99.9 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 99.89 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 99.89 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 99.89 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 99.89 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 99.89 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 99.89 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 99.89 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 99.89 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 99.89 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 99.88 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 99.88 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 99.88 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 99.88 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 99.88 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 99.88 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 99.88 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 99.88 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 99.88 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 99.88 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 99.88 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 99.88 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 99.87 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 99.87 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 99.87 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 99.87 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 99.87 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 99.87 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 99.87 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 99.86 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 99.86 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 99.86 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 99.86 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 99.86 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 99.86 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 99.86 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 99.86 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 99.85 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 99.85 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 99.85 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 99.85 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 99.84 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 99.84 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 99.83 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 99.82 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 99.81 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 99.81 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 99.8 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 99.79 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 99.74 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 99.74 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 99.69 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 99.69 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 98.41 | |
| 3nx6_A | 95 | 10KDA chaperonin; bacterial blight, XOO4289, groes | 93.52 | |
| 1g31_A | 111 | GP31; chaperone, CO-chaperonin, groes, in VIVO pro | 93.2 | |
| 1pcq_O | 97 | Groes protein; chaperone; HET: ADP; 2.81A {Escheri | 91.31 | |
| 1p3h_A | 99 | 10 kDa chaperonin; beta barrel, acidic cluster, fl | 89.97 | |
| 1we3_O | 100 | CPN10(groes); chaperonin, chaperone, groel, HSP60, | 89.78 |
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
Probab=99.91 E-value=6.2e-24 Score=139.60 Aligned_cols=88 Identities=35% Similarity=0.494 Sum_probs=82.5
Q ss_pred CeEEEEcccCCCCceEEEEecCCCCCCCCeEEEEEeEEecChhHHHHHhCCCCCCCCCCcccccceEEEEEEeCCCCCCC
Q psy3511 1 MLAVQCKRWGEPRVLELTTVDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKHF 80 (91)
Q Consensus 1 m~a~~~~~~~~~~~~~~~~~~~p~~~~~~ev~v~v~~~~l~~~d~~~~~g~~~~~~~~p~~~g~e~~G~V~~vG~~~~~~ 80 (91)
|||+++.++++++.+++++.+.|+ ++++||+||+++++||++|++.+.|.++....+|.++|+|++|+|+++|+++++|
T Consensus 29 MkA~~~~~~g~~~~l~~~~~~~P~-~~~~eVlVkv~a~gi~~~D~~~~~g~~~~~~~~p~i~G~E~~G~V~~vG~~v~~~ 107 (353)
T 4dup_A 29 MRFVDLKSFGGPDVMVIGKRPLPV-AGEGEVLVRAEAIGVNRPDIAQRQGSYPPPKDASPILGLELSGEIVGVGPGVSGY 107 (353)
T ss_dssp EEEEEESSSSSGGGEEEEEECCCC-CCTTEEEEEEEEEEECHHHHHHHTTSSCCCTTSCSSSCCEEEEEEEEECTTCCSC
T ss_pred eeEEEEccCCCccceEEEeccCCC-CCCCEEEEEEEEEecCHHHHHHhCCCCCCCCCCCCccccccEEEEEEECCCCCCC
Confidence 899999999988899999999999 9999999999999999999999999876555678999999999999999999999
Q ss_pred CCCCEEEee
Q psy3511 81 KVKNIVRSS 89 (91)
Q Consensus 81 ~~Gd~V~~~ 89 (91)
++||||++.
T Consensus 108 ~vGdrV~~~ 116 (353)
T 4dup_A 108 AVGDKVCGL 116 (353)
T ss_dssp CTTCEEEEE
T ss_pred CCCCEEEEe
Confidence 999999875
|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} SCOP: b.35.1.0 | Back alignment and structure |
|---|
| >1g31_A GP31; chaperone, CO-chaperonin, groes, in VIVO protein folding, bacteriophage T4; 2.30A {Enterobacteria phage T4} SCOP: b.35.1.1 PDB: 2cgt_O | Back alignment and structure |
|---|
| >1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O | Back alignment and structure |
|---|
| >1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A | Back alignment and structure |
|---|
| >1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 91 | ||||
| d1llua1 | 175 | b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase | 4e-12 | |
| d1yb5a1 | 150 | b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductas | 1e-10 | |
| d1rjwa1 | 171 | b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase | 2e-10 | |
| d1jvba1 | 177 | b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase | 1e-09 | |
| d2fzwa1 | 197 | b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase | 7e-09 | |
| d1o89a1 | 146 | b.35.1.2 (A:1-115,A:293-323) Hypothetical protein | 8e-09 | |
| d1xa0a1 | 152 | b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo | 9e-09 | |
| d1piwa1 | 192 | b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy | 1e-08 | |
| d1f8fa1 | 194 | b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr | 2e-08 | |
| d1qora1 | 147 | b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductas | 8e-08 | |
| d1e3ja1 | 178 | b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor | 4e-07 | |
| d1pl8a1 | 185 | b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor | 4e-07 | |
| d1cdoa1 | 199 | b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase | 4e-07 | |
| d1e3ia1 | 202 | b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase | 4e-07 | |
| d1p0fa1 | 198 | b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro | 6e-07 | |
| d1gu7a1 | 175 | b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu | 8e-07 | |
| d1tt7a1 | 162 | b.35.1.2 (A:2-127,A:295-330) Hypothetical protein | 3e-06 | |
| d1iz0a1 | 131 | b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase | 7e-06 | |
| d2jhfa1 | 198 | b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase | 8e-06 | |
| d1vj0a1 | 184 | b.35.1.2 (A:2-155,A:338-367) Hypothetical protein | 1e-05 | |
| d1kola1 | 201 | b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog | 1e-05 | |
| d1h2ba1 | 171 | b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas | 2e-05 | |
| d1uufa1 | 179 | b.35.1.2 (A:3-144,A:313-349) Hypothetical protein | 3e-04 | |
| d1jqba1 | 177 | b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon | 0.002 | |
| d1v3va1 | 147 | b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hyd | 0.003 |
| >d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 | Back information, alignment and structure |
|---|
class: All beta proteins fold: GroES-like superfamily: GroES-like family: Alcohol dehydrogenase-like, N-terminal domain domain: Alcohol dehydrogenase species: Pseudomonas aeruginosa [TaxId: 287]
Score = 56.5 bits (135), Expect = 4e-12
Identities = 31/86 (36%), Positives = 41/86 (47%), Gaps = 3/86 (3%)
Query: 1 MLAVQCKRWGEPRVLELTTVDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLPA 60
M A +G P +E V PGP +VLVK+ A+G+ + + G +P P LP
Sbjct: 6 MKAAVVHAYGAPLRIEEVKVPLPGP---GQVLVKIEASGVCHTDLHAAEGDWPVKPPLPF 62
Query: 61 ILGTEVSGIVEEVGQGVKHFKVKNIV 86
I G E G V VG GV K + V
Sbjct: 63 IPGHEGVGYVAAVGSGVTRVKEGDRV 88
|
| >d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 | Back information, alignment and structure |
|---|
| >d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 | Back information, alignment and structure |
|---|
| >d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 | Back information, alignment and structure |
|---|
| >d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 146 | Back information, alignment and structure |
|---|
| >d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 | Back information, alignment and structure |
|---|
| >d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 | Back information, alignment and structure |
|---|
| >d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 | Back information, alignment and structure |
|---|
| >d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 147 | Back information, alignment and structure |
|---|
| >d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 | Back information, alignment and structure |
|---|
| >d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 | Back information, alignment and structure |
|---|
| >d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 | Back information, alignment and structure |
|---|
| >d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 | Back information, alignment and structure |
|---|
| >d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 | Back information, alignment and structure |
|---|
| >d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 | Back information, alignment and structure |
|---|
| >d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 | Back information, alignment and structure |
|---|
| >d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 | Back information, alignment and structure |
|---|
| >d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 | Back information, alignment and structure |
|---|
| >d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 | Back information, alignment and structure |
|---|
| >d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 | Back information, alignment and structure |
|---|
| >d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 | Back information, alignment and structure |
|---|
| >d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 | Back information, alignment and structure |
|---|
| >d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 147 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| d1yb5a1 | 150 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 99.95 | |
| d1llua1 | 175 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 99.94 | |
| d1jvba1 | 177 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 99.93 | |
| d1rjwa1 | 171 | Alcohol dehydrogenase {Bacillus stearothermophilus | 99.93 | |
| d1qora1 | 147 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 99.93 | |
| d1p0fa1 | 198 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 99.93 | |
| d2jhfa1 | 198 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 99.92 | |
| d1e3ia1 | 202 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 99.92 | |
| d1jqba1 | 177 | Bacterial secondary alcohol dehydrogenase {Clostri | 99.92 | |
| d1uufa1 | 179 | Hypothetical protein YahK {Escherichia coli [TaxId | 99.92 | |
| d1f8fa1 | 194 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 99.92 | |
| d2fzwa1 | 197 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 99.92 | |
| d1h2ba1 | 171 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 99.9 | |
| d1piwa1 | 192 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 99.9 | |
| d1vj0a1 | 184 | Hypothetical protein TM0436 {Thermotoga maritima [ | 99.9 | |
| d1e3ja1 | 178 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 99.9 | |
| d1cdoa1 | 199 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 99.9 | |
| d1pl8a1 | 185 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 99.9 | |
| d1kola1 | 201 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 99.89 | |
| d1o89a1 | 146 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.89 | |
| d1xa0a1 | 152 | B. subtilis YhfP homologue {Bacillus stearothermop | 99.87 | |
| d1iz0a1 | 131 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 99.87 | |
| d1tt7a1 | 162 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 99.83 | |
| d1gu7a1 | 175 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 99.81 | |
| d1vj1a1 | 166 | Putative zinc-binding alcohol dehydrogenase {Mouse | 99.62 | |
| d1v3va1 | 147 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 99.6 | |
| d1p3ha_ | 99 | Chaperonin-10 (GroES) {Mycobacterium tuberculosis | 91.92 | |
| d1aono_ | 97 | Chaperonin-10 (GroES) {Escherichia coli [TaxId: 56 | 90.72 | |
| d1we3o_ | 96 | Chaperonin-10 (GroES) {Thermus thermophilus [TaxId | 81.14 | |
| d1g31a_ | 107 | GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665 | 80.98 |
| >d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: GroES-like superfamily: GroES-like family: Alcohol dehydrogenase-like, N-terminal domain domain: Quinone oxidoreductase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=6.2e-27 Score=137.31 Aligned_cols=89 Identities=45% Similarity=0.700 Sum_probs=82.6
Q ss_pred CeEEEEcccCCCCceEEE-EecCCCCCCCCeEEEEEeEEecChhHHHHHhCCCCCCCCCCcccccceEEEEEEeCCCCCC
Q psy3511 1 MLAVQCKRWGEPRVLELT-TVDKPGPCLDDEVLVKVMAAGINPVETYIRSGQYPNLPDLPAILGTEVSGIVEEVGQGVKH 79 (91)
Q Consensus 1 m~a~~~~~~~~~~~~~~~-~~~~p~~~~~~ev~v~v~~~~l~~~d~~~~~g~~~~~~~~p~~~g~e~~G~V~~vG~~~~~ 79 (91)
|||++++++|+++.+++. +.+.|. +++|||+||+++++||+.|++.+.|.++....+|.++|+|++|+|+++|+++++
T Consensus 3 MkAv~~~~~G~p~~l~~~~~~~~P~-~~~~eVlVkv~a~~i~~~D~~~~~g~~~~~~~~p~i~G~e~~G~V~~vG~~v~~ 81 (150)
T d1yb5a1 3 MRAVRVFEFGGPEVLKLRSDIAVPI-PKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASA 81 (150)
T ss_dssp EEEEEESSCSSGGGEEEEEEEECCC-CCTTEEEEEEEEEECCHHHHHHHHTCSSCCCCSSBCCCSCEEEEEEEECTTCTT
T ss_pred eeEEEEEccCCcceEEEEeecCCCC-CCCCeEEEEEEEecCcccchhhhcCCcCccccccccCccceeeeeEeecceeec
Confidence 899999999999999986 679999 999999999999999999999999988766678899999999999999999999
Q ss_pred CCCCCEEEeeC
Q psy3511 80 FKVKNIVRSSK 90 (91)
Q Consensus 80 ~~~Gd~V~~~~ 90 (91)
|++||||++..
T Consensus 82 ~~vGdrV~~~~ 92 (150)
T d1yb5a1 82 FKKGDRVFTSS 92 (150)
T ss_dssp CCTTCEEEESC
T ss_pred cccCccccccc
Confidence 99999998753
|
| >d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g31a_ b.35.1.1 (A:) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|