Diaphorina citri psyllid: psy3537

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MNDLNTMEMTLNFLNWPKTMVDAIVCDGFHYDSDDYWKCTIKRRSSSYYHLSSTARMGDNILTSVVNYKLQVHGLENVRIADASVMPYTVNANIHATCVMIGEKCADLIKQYWEKSV
cHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHcc
**D*NT*EMTLNFLNWPKTMVDAIVCDGFHYDSDDYWKCTIKRRSSSYYHLSSTARMGDNILTSVVNYKLQVHGLENVRIADASVMPYTVNANIHATCVMIGEKCADLIKQYWEK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDLNTMEMTLNFLNWPKTMVDAIVCDGFHYDSDDYWKCTIKRRSSSYYHLSSTARMGDNILTSVVNYKLQVHGLENVRIADASVMPYTVNANIHATCVMIGEKCADLIKQYWEKSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized GMC-type oxidoreductase Mb1310 confidentP64264
Uncharacterized GMC-type oxidoreductase Rv1279/MT1316 confidentP64263

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q9T, chain A
Confidence level:very confident
Coverage over the Query: 1-115
View the alignment between query and template
View the model in PyMOL