Diaphorina citri psyllid: psy3543

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
AERLSNHAFSLEVVTAIDINTSANSVYKHNFPRTNLRGRNIQSFSIEEINAMSPDVILMSPPCQPFTRTGLQKDIADARCTALSYLIETIPAIPSLQCLLLENVKGFEGSRSRDLITSMLTRAGFRFQEFLLSPTQFGVPNSRTRYYLIAKRSPAAHSSEASFCFETSSELMTELPKLKANTCNPLLSRMTLHGILDSTHPSGDLYRRYLVSDKDLLRRFHVFDIVNGKASSTNCFTKAYTHYAEGKIDY
cccccccccccEEEEEEcccHHHHHHHHHHcccccccccccccccccccccccccEEEEcccccHHHHccccccccccccccHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccEEEEEEEEcccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccEEEEccccEEEEEECcc
AERLSNHAFSLEVVTAIDINTSANSVYKHNFPRTNLRGRNIQSFSIEEINAMSPDVILMSPPCQPFTRTGLQKDIADARCTALSYLIETIPAIPSLQCLLLENVKGFEGSRSRDLITSMLTRAGFRFQEFLLSPTQFGVPNSRTRYYLIAKRSPAAHSSEASFCFETSSELMTELPKLKANTCNPLLSRMTLHGILDSTHPSGDLYRRYLVSDKDLLRRFHVFDIVNGKASSTNCFTKAYTHYAEGKI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AERLSNHAFSLEVVTAIDINTSANSVYKHNFPRTNLRGRNIQSFSIEEINAMSPDVILMSPPCQPFTRTGLQKDIADARCTALSYLIETIPAIPSLQCLLLENVKGFEGSRSRDLITSMLTRAGFRFQEFLLSPTQFGVPNSRTRYYLIAKRSPAAHSSEASFCFETSSELMTELPKLKANTCNPLLSRMTLHGILDSTHPSGDLYRRYLVSDKDLLRRFHVFDIVNGKASSTNCFTKAYTHYAEGKIDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA (cytosine-5)-methyltransferase Involved in epigenetic gene silencing. Methylates specific cytosine residues in the retrotransposons DIRS-1 and Skipper.confidentQ54JH6
tRNA (cytosine(38)-C(5))-methyltransferase Does not have a cytosine-5 methyltransferase activity due to the insertion of a Ser residue between the Pro-Cys motif found at the active site of C5 MTases. When this serine is deleted it becomes catalytically active and recognizes and methylates the sequence CC[AT]GG.confidentP40999

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G55, chain A
Confidence level:very confident
Coverage over the Query: 2-62,81-249
View the alignment between query and template
View the model in PyMOL