Diaphorina citri psyllid: psy355

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----

MNEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYVCSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRDNEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSTEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEHVNSVLTEVFEEDSLEEFDHQDR

ccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHccccc

*NEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYVCSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRDNEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSTEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEHVNSVLTEVF*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Hsp70-binding protein 1	Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of target proteins.	confident	Q99P31
Hsp70-binding protein 1	Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.	confident	Q9NZL4
Hsp70-binding protein 1	Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of target proteins.	confident	Q6IMX7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0032436 [BP]	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0009896, GO:0009894, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:1901800, GO:0048518, GO:0065007, GO:0060255, GO:0031331, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0061136, GO:0045862, GO:0048522
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0031398 [BP]	positive regulation of protein ubiquitination	probable	GO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XQR, chain A
Confidence level:very confident
Coverage over the Query: 14-230
View the alignment between query and template
View the model in PyMOL