Psyllid ID: psy3574


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MSRVFNHFLQVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKVSNPPTTYTDLEPDDDGEIPNVPQRIQSRLLTARNNHARNPNIDESEVFSLPDVSAPWNSTLST
ccEEcccccccEEEEEccccccccccEEEcccccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEcEEHHHcHHHHcccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccEEEEccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccc
cccEHHHHHHHHHHHHcccccHHHHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHHHHHHHHccccccccccccHHEEEEEcccccccHHHHHHHHHHHHHHHcccccccccccHHEEEEccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHccHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MSRVFNHFLQVAAVErkggynqqcdiWAVGITAIElaelqppmfdlhpmRALFlmsksgfkppalkdkdrcgdvkladfgvSAQITATINKRksfigtpywmapevaaverkggynqqcdiWAVGITAIElaelqppmfdlhpmRALFlmsksgfkppalkdkdrwssTFHNFVKIAltknpkkrptaDKLLQVILIHRARVAAVerkggynqqcdiwahpffkydMSKRVAIELLQKvsnppttytdlepdddgeipnvpQRIQSRLLTARnnharnpnidesevfslpdvsapwnstlst
MSRVFNHFLQVAAverkggynqQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLAdfgvsaqitatinkrksfigtpYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKialtknpkkrptaDKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKvsnppttytdlepdddgeipNVPQRIQSRLLTarnnharnpnidesevfslpdvsapwnstlst
MSRVFNHFLQVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKVSNPPTTYTDLEPDDDGEIPNVPQRIQSRLLTARNNHARNPNIDESEVFSLPDVSAPWNSTLST
***VFNHFLQVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFK**ALKDKDRWSSTFHNFVKIALTKNP**RPTADKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKV***************************************************************
MSRVFNHFLQVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSG**********RWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGY*******************************************************************************************
MSRVFNHFLQVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKVSNPPTTYTDLEPDDDGEIPNVPQRIQSRLLTARNNHARNPNIDESEVFSLPDVSA********
MSRVFNHFLQVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGYNQQCDIWA********SKR****LLQ*V***************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRVFNHFLQVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKVSNPPTTYTDLEPDDDGEIPNVPQRIQSRLLTARNNHARNPNIDESEVFSLPDVSAPWNSTLST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query302 2.2.26 [Sep-21-2011]
Q8IVH8 894 Mitogen-activated protein yes N/A 0.781 0.263 0.535 7e-68
Q924I2 873 Mitogen-activated protein yes N/A 0.781 0.270 0.535 3e-67
Q99JP0 894 Mitogen-activated protein yes N/A 0.781 0.263 0.531 1e-66
Q9Y4K4 846 Mitogen-activated protein no N/A 0.589 0.210 0.616 2e-62
Q8BPM2 847 Mitogen-activated protein no N/A 0.589 0.210 0.626 4e-62
Q12851 820 Mitogen-activated protein no N/A 0.480 0.176 0.602 1e-55
Q61161 821 Mitogen-activated protein no N/A 0.509 0.187 0.576 4e-55
P70218 827 Mitogen-activated protein no N/A 0.413 0.151 0.720 3e-53
Q92918 833 Mitogen-activated protein no N/A 0.417 0.151 0.698 4e-51
Q0IHQ8 951 Serine/threonine-protein no N/A 0.397 0.126 0.532 3e-33
>sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 Back     alignment and function desciption
 Score =  257 bits (657), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 145/271 (53%), Positives = 173/271 (63%), Gaps = 35/271 (12%)

Query: 13  AVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRC- 71
            +E  GG + Q DI+ V      L+ELQ        ++ L+ +   G     +K  +   
Sbjct: 89  CMEFCGGGSLQ-DIYHV---TGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILL 144

Query: 72  ---GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITA 128
              G VKLADFGVSAQITATI KRKSFIGTPYWMAPEVAAVERKGGYNQ CD+WAVGITA
Sbjct: 145 TDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAVGITA 204

Query: 129 IELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTA 188
           IELAELQPPMFDLHPMRALFLM+KS F+PP LKDK +WS++FH+FVK+ALTKNPKKRPTA
Sbjct: 205 IELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTA 264

Query: 189 DKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKVSNPP-TTYT 247
           +KLLQ                          HPF    +++ +AIELL KV+NP  +TY 
Sbjct: 265 EKLLQ--------------------------HPFVTQHLTRSLAIELLDKVNNPDHSTYH 298

Query: 248 DLEPDDDGEIPNVPQRIQSRLLTARNNHARN 278
           D + DD   +  VP RI S     R    R+
Sbjct: 299 DFDDDDPEPLVAVPHRIHSTSRNVREEKTRS 329




May play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 Back     alignment and function description
>sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 Back     alignment and function description
>sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 Back     alignment and function description
>sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=2 SV=2 Back     alignment and function description
>sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 Back     alignment and function description
>sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 Back     alignment and function description
>sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 Back     alignment and function description
>sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 Back     alignment and function description
>sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
332025920 897 Mitogen-activated protein kinase kinase 0.576 0.193 0.751 7e-80
189235723 761 PREDICTED: similar to mitogen-activated 0.615 0.244 0.712 1e-79
350407772 900 PREDICTED: mitogen-activated protein kin 0.576 0.193 0.746 3e-79
340717282 901 PREDICTED: mitogen-activated protein kin 0.576 0.193 0.746 4e-79
322792326 884 hypothetical protein SINV_06196 [Solenop 0.576 0.196 0.751 4e-79
340717284 896 PREDICTED: mitogen-activated protein kin 0.562 0.189 0.75 4e-79
383856072 900 PREDICTED: mitogen-activated protein kin 0.576 0.193 0.746 5e-79
383856074 896 PREDICTED: mitogen-activated protein kin 0.562 0.189 0.75 5e-79
270003381 857 hypothetical protein TcasGA2_TC002609 [T 0.639 0.225 0.688 5e-79
307191886 882 Mitogen-activated protein kinase kinase 0.576 0.197 0.741 2e-78
>gi|332025920|gb|EGI66076.1| Mitogen-activated protein kinase kinase kinase kinase 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  303 bits (776), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 162/201 (80%), Gaps = 27/201 (13%)

Query: 72  GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIEL 131
           GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQ CDIWA GITAIEL
Sbjct: 154 GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGITAIEL 213

Query: 132 AELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKL 191
           AELQPPMFDLHPMRALFLMSKSGFKPP LKD+D+WS TFHNFVK+ALTKNPKKRPTA+KL
Sbjct: 214 AELQPPMFDLHPMRALFLMSKSGFKPPTLKDRDKWSPTFHNFVKVALTKNPKKRPTAEKL 273

Query: 192 LQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKVSNPPTTYTDLEP 251
           LQ                          H FF+ +MSKR+A+ELLQKVSNP   +TDLE 
Sbjct: 274 LQ--------------------------HAFFQGEMSKRLALELLQKVSNPSHMFTDLEA 307

Query: 252 DDDGEIPNVPQRIQSRLLTAR 272
           D+DG +PNVPQRI SR LTAR
Sbjct: 308 DEDGAVPNVPQRIASR-LTAR 327




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189235723|ref|XP_001807436.1| PREDICTED: similar to mitogen-activated protein kinase kinase kinase kinase 2-like [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350407772|ref|XP_003488189.1| PREDICTED: mitogen-activated protein kinase kinase kinase kinase 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340717282|ref|XP_003397114.1| PREDICTED: mitogen-activated protein kinase kinase kinase kinase 5-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|322792326|gb|EFZ16310.1| hypothetical protein SINV_06196 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340717284|ref|XP_003397115.1| PREDICTED: mitogen-activated protein kinase kinase kinase kinase 5-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383856072|ref|XP_003703534.1| PREDICTED: mitogen-activated protein kinase kinase kinase kinase 5-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383856074|ref|XP_003703535.1| PREDICTED: mitogen-activated protein kinase kinase kinase kinase 5-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|270003381|gb|EEZ99828.1| hypothetical protein TcasGA2_TC002609 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307191886|gb|EFN75305.1| Mitogen-activated protein kinase kinase kinase kinase 5 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
FB|FBgn0263395 1218 hppy "happyhour" [Drosophila m 0.403 0.100 0.909 8.9e-66
UNIPROTKB|F1NLQ4 869 MAP4K3 "Mitogen-activated prot 0.403 0.140 0.877 1.9e-63
UNIPROTKB|F1N2U3 846 MAP4K5 "Mitogen-activated prot 0.447 0.159 0.804 1e-60
UNIPROTKB|F1NAN8 846 MAP4K5 "Mitogen-activated prot 0.400 0.143 0.892 2.1e-60
MGI|MGI:1925503 847 Map4k5 "mitogen-activated prot 0.447 0.159 0.804 2.8e-60
ZFIN|ZDB-GENE-030131-6497 878 map4k5 "mitogen-activated prot 0.417 0.143 0.793 3.4e-57
UNIPROTKB|F5H5A3 810 MAP4K3 "Mitogen-activated prot 0.701 0.261 0.590 4.6e-57
UNIPROTKB|Q8IVH8 894 MAP4K3 "Mitogen-activated prot 0.701 0.237 0.590 1.4e-56
ZFIN|ZDB-GENE-060512-339 889 zgc:136354 "zgc:136354" [Danio 0.403 0.137 0.811 1.8e-56
UNIPROTKB|F1S4T3 492 LOC100520016 "Uncharacterized 0.701 0.430 0.585 3.3e-56
FB|FBgn0263395 hppy "happyhour" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 596 (214.9 bits), Expect = 8.9e-66, Sum P(2) = 8.9e-66
 Identities = 111/122 (90%), Positives = 116/122 (95%)

Query:    72 GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIEL 131
             GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQ CDIWA GITAIEL
Sbjct:   158 GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQLCDIWACGITAIEL 217

Query:   132 AELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKL 191
             AELQPPMFDLHPMRALFLMSKSGFKPP L +KD+WS TFHNF+K ALTKNPKKRPTA++L
Sbjct:   218 AELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERL 277

Query:   192 LQ 193
             LQ
Sbjct:   278 LQ 279


GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=IGI;NAS
GO:0004702 "receptor signaling protein serine/threonine kinase activity" evidence=NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0005083 "small GTPase regulator activity" evidence=IEA
GO:0004672 "protein kinase activity" evidence=IGI
GO:0032008 "positive regulation of TOR signaling cascade" evidence=IGI
GO:0042059 "negative regulation of epidermal growth factor receptor signaling pathway" evidence=IGI
GO:0048149 "behavioral response to ethanol" evidence=IMP
GO:0070328 "triglyceride homeostasis" evidence=IMP
GO:0040009 "regulation of growth rate" evidence=IMP
GO:0008361 "regulation of cell size" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0032006 "regulation of TOR signaling cascade" evidence=IGI
GO:0043065 "positive regulation of apoptotic process" evidence=IMP
GO:0031931 "TORC1 complex" evidence=IPI
GO:0046626 "regulation of insulin receptor signaling pathway" evidence=IGI
GO:0046330 "positive regulation of JNK cascade" evidence=IMP
GO:0006915 "apoptotic process" evidence=IDA
GO:0007254 "JNK cascade" evidence=IDA
GO:0007030 "Golgi organization" evidence=IMP
UNIPROTKB|F1NLQ4 MAP4K3 "Mitogen-activated protein kinase kinase kinase kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2U3 MAP4K5 "Mitogen-activated protein kinase kinase kinase kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAN8 MAP4K5 "Mitogen-activated protein kinase kinase kinase kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1925503 Map4k5 "mitogen-activated protein kinase kinase kinase kinase 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6497 map4k5 "mitogen-activated protein kinase kinase kinase kinase 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F5H5A3 MAP4K3 "Mitogen-activated protein kinase kinase kinase kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IVH8 MAP4K3 "Mitogen-activated protein kinase kinase kinase kinase 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060512-339 zgc:136354 "zgc:136354" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S4T3 LOC100520016 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99JP0M4K3_MOUSE2, ., 7, ., 1, 1, ., 10.53130.78140.2639yesN/A
Q8IVH8M4K3_HUMAN2, ., 7, ., 1, 1, ., 10.53500.78140.2639yesN/A
Q924I2M4K3_RAT2, ., 7, ., 1, 1, ., 10.53500.78140.2703yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 1e-92
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 4e-79
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 3e-77
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 2e-54
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 3e-54
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 8e-54
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 6e-53
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-49
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 1e-48
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 8e-42
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 9e-40
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 6e-39
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 4e-38
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 6e-38
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-37
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 6e-37
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 2e-36
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 4e-36
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 6e-36
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 4e-35
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 3e-33
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 5e-33
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 1e-32
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 2e-32
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 2e-32
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 4e-32
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 2e-31
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 1e-30
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-30
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 3e-30
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 1e-29
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 3e-28
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-28
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 7e-28
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 7e-28
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 8e-28
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-27
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 8e-27
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 1e-26
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 5e-26
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 8e-24
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 6e-23
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-22
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-22
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 4e-22
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 1e-20
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 2e-19
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-19
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 7e-19
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 3e-18
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 1e-17
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 9e-17
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 1e-16
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 2e-16
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 3e-16
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 4e-16
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 4e-16
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 6e-16
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 9e-16
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 2e-15
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 1e-14
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-14
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 2e-14
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-14
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 2e-14
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 2e-14
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 3e-14
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 1e-13
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 1e-13
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 2e-13
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 2e-13
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 4e-13
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 4e-13
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 4e-13
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 1e-12
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 2e-12
smart00750176 smart00750, KIND, kinase non-catalytic C-lobe doma 3e-12
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 3e-12
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 7e-12
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 1e-11
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 2e-11
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 2e-11
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-11
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 2e-11
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 2e-11
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 4e-11
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 6e-11
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 7e-11
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 1e-10
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 1e-10
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 1e-10
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 2e-10
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 2e-10
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 3e-10
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 4e-10
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 5e-10
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 7e-10
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 8e-10
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 8e-10
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 2e-09
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-09
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 2e-09
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-09
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 8e-09
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 1e-08
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-08
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-08
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 1e-08
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-08
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-08
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-08
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-08
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 2e-08
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 3e-08
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 3e-08
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 4e-08
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 4e-08
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 4e-08
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 4e-08
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 6e-08
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 6e-08
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 2e-07
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 2e-07
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 3e-07
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 3e-07
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 4e-07
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-07
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 6e-07
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 1e-06
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 1e-06
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 1e-06
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 1e-06
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 1e-06
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 1e-06
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 1e-06
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 1e-06
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 1e-06
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 2e-06
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 2e-06
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 2e-06
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 2e-06
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 2e-06
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 3e-06
cd08227327 cd08227, PK_STRAD_alpha, Pseudokinase domain of ST 3e-06
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 3e-06
cd08226328 cd08226, PK_STRAD_beta, Pseudokinase domain of STE 3e-06
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 4e-06
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 6e-06
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 6e-06
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 6e-06
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 6e-06
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 7e-06
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 8e-06
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 9e-06
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 1e-05
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 2e-05
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 2e-05
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 2e-05
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 3e-05
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 3e-05
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 3e-05
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 5e-05
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 6e-05
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 8e-05
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 8e-05
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 9e-05
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 1e-04
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 1e-04
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 1e-04
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 1e-04
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 1e-04
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-04
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 2e-04
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 2e-04
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-04
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 2e-04
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 3e-04
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 3e-04
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 3e-04
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 4e-04
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 5e-04
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 5e-04
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 5e-04
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 6e-04
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 6e-04
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 6e-04
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 7e-04
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 8e-04
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 8e-04
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 8e-04
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 0.001
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 0.001
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 0.001
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 0.001
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 0.002
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 0.002
cd08226328 cd08226, PK_STRAD_beta, Pseudokinase domain of STE 0.002
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 0.002
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 0.002
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 0.002
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 0.002
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 0.002
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 0.002
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 0.003
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 0.003
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 0.003
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 0.003
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 0.004
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
 Score =  275 bits (705), Expect = 1e-92
 Identities = 102/122 (83%), Positives = 112/122 (91%)

Query: 72  GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIEL 131
           GDVKLADFGVSAQ+TATI KRKSFIGTPYWMAPEVAAVERKGGY+ +CDIWA+GITAIEL
Sbjct: 138 GDVKLADFGVSAQLTATIAKRKSFIGTPYWMAPEVAAVERKGGYDGKCDIWALGITAIEL 197

Query: 132 AELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKL 191
           AELQPPMFDLHPMRALFL+SKS F PP LKDK++WS  FH+F+K  LTK+PKKRPTA KL
Sbjct: 198 AELQPPMFDLHPMRALFLISKSNFPPPKLKDKEKWSPVFHDFIKKCLTKDPKKRPTATKL 257

Query: 192 LQ 193
           LQ
Sbjct: 258 LQ 259


Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated either by a small GTP-binding protein or by an adaptor protein, which transmits the signal either directly to a MAP3K to start the triple kinase core cascade or indirectly through a mediator kinase, a MAP4K. MAP4K1, also called haematopoietic progenitor kinase 1 (HPK1), is a hematopoietic-specific STK involved in many cellular signaling cascades including MAPK, antigen receptor, apoptosis, growth factor, and cytokine signaling. It participates in the regulation of T cell receptor signaling and T cell-mediated immune responses. MAP4K2 was referred to as germinal center (GC) kinase because of its preferred location in GC B cells. MAP4K3 plays a role in the nutrient-responsive pathway of mTOR (mammalian target of rapamycin) signaling. It is required in the activation of S6 kinase by amino acids and for the phosphorylation of the mTOR-regulated inhibitor of eukaryotic initiation factor 4E. MAP4K5, also called germinal center kinase-related enzyme (GCKR), has been shown to activate the MAPK c-Jun N-terminal kinase (JNK). Length = 262

>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|214801 smart00750, KIND, kinase non-catalytic C-lobe domain Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 302
KOG0616|consensus355 100.0
KOG0598|consensus357 100.0
KOG0575|consensus 592 100.0
KOG0592|consensus 604 100.0
KOG0581|consensus364 100.0
KOG0615|consensus475 100.0
KOG0605|consensus550 100.0
KOG0694|consensus694 100.0
KOG0578|consensus550 100.0
KOG0033|consensus355 100.0
KOG0588|consensus 786 100.0
KOG0583|consensus370 100.0
KOG0696|consensus683 100.0
KOG0579|consensus 1187 100.0
KOG0591|consensus375 100.0
KOG0661|consensus 538 100.0
KOG0599|consensus411 100.0
KOG0595|consensus429 100.0
KOG0593|consensus396 100.0
KOG0610|consensus459 100.0
KOG0198|consensus313 100.0
KOG0201|consensus467 100.0
KOG0690|consensus516 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
KOG0574|consensus 502 100.0
KOG0986|consensus591 100.0
KOG0582|consensus 516 100.0
KOG0597|consensus 808 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
KOG0612|consensus 1317 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
KOG0660|consensus359 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
KOG0614|consensus732 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
KOG0604|consensus400 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
KOG4717|consensus 864 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
KOG0589|consensus426 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
KOG0663|consensus419 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0659|consensus318 100.0
KOG0658|consensus364 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
KOG0032|consensus382 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
KOG0580|consensus281 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
KOG0611|consensus 668 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
KOG0600|consensus560 100.0
KOG0585|consensus576 100.0
KOG0192|consensus362 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
KOG0695|consensus593 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
KOG0577|consensus 948 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
KOG0608|consensus1034 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
KOG4721|consensus 904 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
KOG0594|consensus323 100.0
KOG4645|consensus1509 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
KOG0596|consensus677 100.0
KOG0667|consensus586 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
KOG4279|consensus 1226 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
KOG0983|consensus391 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
KOG1989|consensus 738 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
KOG0197|consensus468 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
KOG0576|consensus 829 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
KOG0584|consensus 632 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
KOG0603|consensus612 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
KOG0587|consensus 953 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
KOG0607|consensus463 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
PHA03211461 serine/threonine kinase US3; Provisional 99.98
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.98
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.98
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.98
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.98
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.98
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.98
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.98
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.98
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.98
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.98
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.98
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.98
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.97
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.97
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.97
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.97
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.97
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.97
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.97
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.97
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.97
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.97
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.97
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.97
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.97
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.97
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.97
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.97
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.97
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.97
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.97
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.97
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.97
KOG0665|consensus369 99.97
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.97
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.97
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.97
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.97
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.97
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.97
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.97
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.97
KOG0586|consensus 596 99.97
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.97
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.97
KOG0193|consensus678 99.97
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.97
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.97
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.97
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.97
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.97
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.97
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.97
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.97
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.97
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.97
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.97
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.97
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.97
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.97
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.97
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.97
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.97
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.97
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.97
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.97
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.97
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.97
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.97
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.97
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.97
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.97
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.97
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.97
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.97
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.97
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.97
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.97
PLN00009294 cyclin-dependent kinase A; Provisional 99.97
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.97
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.97
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.97
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.97
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.97
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.97
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.97
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.97
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.97
PHA03210501 serine/threonine kinase US3; Provisional 99.97
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.97
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.97
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.97
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.97
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.97
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.97
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.97
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.97
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.97
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.97
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.97
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.97
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.97
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.97
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.97
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.97
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.97
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.97
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.97
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.97
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.97
KOG1006|consensus361 99.97
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.97
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.97
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.97
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.97
KOG0666|consensus438 99.97
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.97
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.97
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.97
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.97
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.97
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.97
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.97
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.97
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.97
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.97
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.97
KOG0671|consensus415 99.97
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.97
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.97
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.97
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.97
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.97
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.97
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.97
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.97
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.97
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.97
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.97
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.97
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.97
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.97
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.97
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.97
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.97
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.97
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.97
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.97
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.97
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.97
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.97
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.97
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.97
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.97
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.97
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.97
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.97
KOG2345|consensus302 99.96
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.96
KOG0669|consensus376 99.96
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.96
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.96
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.96
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.96
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.96
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.96
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.96
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.96
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.96
KOG0194|consensus474 99.96
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.96
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.96
KOG0662|consensus292 99.96
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.96
KOG1026|consensus774 99.96
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.96
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.96
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.96
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.96
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.96
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.96
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.96
KOG0670|consensus752 99.96
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.96
PHA02882294 putative serine/threonine kinase; Provisional 99.96
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.96
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.96
KOG1151|consensus775 99.96
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.96
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.96
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.96
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.96
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.96
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.96
KOG0664|consensus449 99.96
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.96
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.96
KOG1095|consensus1025 99.96
KOG1035|consensus 1351 99.96
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.96
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.95
KOG4236|consensus888 99.95
KOG1027|consensus903 99.95
PLN00181 793 protein SPA1-RELATED; Provisional 99.95
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.95
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.95
KOG4250|consensus 732 99.95
KOG0668|consensus338 99.95
KOG0984|consensus282 99.94
KOG4257|consensus 974 99.94
PLN03224507 probable serine/threonine protein kinase; Provisio 99.94
KOG0196|consensus996 99.94
KOG1187|consensus361 99.94
KOG4278|consensus 1157 99.93
KOG0199|consensus 1039 99.93
KOG0200|consensus609 99.92
KOG1290|consensus 590 99.92
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.92
KOG1094|consensus807 99.91
KOG1167|consensus418 99.91
KOG3653|consensus534 99.9
KOG2052|consensus513 99.9
KOG1345|consensus378 99.89
KOG1025|consensus 1177 99.89
KOG1024|consensus563 99.89
KOG0590|consensus601 99.89
KOG0603|consensus 612 99.88
KOG1152|consensus772 99.87
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.86
KOG0606|consensus 1205 99.85
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.83
KOG4158|consensus598 99.78
KOG1033|consensus516 99.76
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.75
KOG1164|consensus322 99.73
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.72
KOG1023|consensus 484 99.68
KOG1240|consensus 1431 99.65
KOG0195|consensus448 99.61
KOG0606|consensus1205 99.61
KOG1165|consensus449 99.6
KOG0590|consensus 601 99.56
KOG1163|consensus341 99.55
PRK12274218 serine/threonine protein kinase; Provisional 99.55
PRK09188365 serine/threonine protein kinase; Provisional 99.52
KOG1166|consensus974 99.39
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.38
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.35
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.34
KOG1266|consensus458 99.25
PRK10345210 hypothetical protein; Provisional 99.15
smart00090237 RIO RIO-like kinase. 99.15
KOG2137|consensus 700 99.09
KOG0601|consensus524 99.07
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.02
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.94
PRK14879211 serine/threonine protein kinase; Provisional 98.92
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.89
KOG1243|consensus 690 98.87
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.84
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.81
KOG0601|consensus524 98.71
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.68
COG4248 637 Uncharacterized protein with protein kinase and he 98.37
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 98.35
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.33
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.3
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.21
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.11
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.04
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 98.04
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 97.97
KOG3741|consensus655 97.91
KOG3087|consensus229 97.9
KOG1035|consensus 1351 97.87
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 97.53
KOG0576|consensus 829 97.35
PRK09902216 hypothetical protein; Provisional 97.25
COG0478304 RIO-like serine/threonine protein kinase fused to 97.17
KOG1826|consensus 2724 97.12
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 96.45
COG1718268 RIO1 Serine/threonine protein kinase involved in c 96.29
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 95.79
COG0661517 AarF Predicted unusual protein kinase [General fun 95.63
KOG2268|consensus465 94.93
KOG1235|consensus538 94.24
KOG1093|consensus 725 92.49
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 90.35
COG5072488 ALK1 Serine/threonine kinase of the haspin family 88.2
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 87.23
KOG2270|consensus520 84.91
>KOG0616|consensus Back     alignment and domain information
Probab=100.00  E-value=2.8e-47  Score=312.92  Aligned_cols=205  Identities=24%  Similarity=0.372  Sum_probs=180.7

Q ss_pred             Cchhhhcch----heeEEEecCCcchHHHHHHhccccccccccchhHHHhhHHHHHHHHHhCCCCCCCCcC----CCCCC
Q psy3574           1 MSRVFNHFL----QVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKD----KDRCG   72 (302)
Q Consensus         1 iv~~~~~~~----~~iv~E~~~~g~L~~~~~~~~~~~~~l~~~~~~~i~~qi~~aL~~lH~~~i~Hrdlkp----~~~~~   72 (302)
                      +|++++.|.    +|+||||++||.|+ .++++.+   +|++..+++++.||+.||+|||+++|++||+||    ++.+|
T Consensus       106 lv~l~~t~~d~~~lymvmeyv~GGElF-S~Lrk~~---rF~e~~arFYAAeivlAleylH~~~iiYRDLKPENiLlD~~G  181 (355)
T KOG0616|consen  106 LVKLYGTFKDNSNLYMVMEYVPGGELF-SYLRKSG---RFSEPHARFYAAEIVLALEYLHSLDIIYRDLKPENLLLDQNG  181 (355)
T ss_pred             eEEEEEeeccCCeEEEEEeccCCccHH-HHHHhcC---CCCchhHHHHHHHHHHHHHHHHhcCeeeccCChHHeeeccCC
Confidence            456666555    69999999999999 8888888   899999999999999999999999999999999    99999


Q ss_pred             CEEEeccccccccccccccccccccCcccchhhcccccccCCCCchhhHHHHHHHHHHHHhCCCCCCCCChHHHHHHHHh
Q psy3574          73 DVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSK  152 (302)
Q Consensus        73 ~ikL~DFg~a~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~~~~DiwslG~il~ell~g~~pf~~~~~~~~~~~i~~  152 (302)
                      ++||+|||+|+.+...   ..+.|||+.|+|||+++   .++|+.++|||||||++|||++|.+||...++..+..+|..
T Consensus       182 ~iKitDFGFAK~v~~r---T~TlCGTPeYLAPEii~---sk~ynkavDWWalGVLIYEMlaG~pPF~~~~~~~iY~KI~~  255 (355)
T KOG0616|consen  182 HIKITDFGFAKRVSGR---TWTLCGTPEYLAPEIIQ---SKGYNKAVDWWALGVLIYEMLAGYPPFYDDNPIQIYEKILE  255 (355)
T ss_pred             cEEEEeccceEEecCc---EEEecCCccccChHHhh---cCCCCcchhHHHHHHHHHHHHcCCCCCcCCChHHHHHHHHh
Confidence            9999999999988753   56789999999999996   88899999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCCCCHHHHHHHHHhhhcCCCCCCCHHHHHHHHHHHhHHHHHHhhhCCC-CCCccccCCCccccchhhHH
Q psy3574         153 SGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGY-NQQCDIWAHPFFKYDMSKRV  231 (302)
Q Consensus       153 ~~~~~~~~~~~~~~s~~~~~li~~~L~~dp~~R~t~~~ll~~l~~~~~~~~~~~~~~~~-~~~~~i~~hp~f~~~~~~~~  231 (302)
                      .....|     ..++.++++||+++|+.|-.+|.                      |+. .|.+||++||||++..|..+
T Consensus       256 ~~v~fP-----~~fs~~~kdLl~~LL~vD~t~R~----------------------gnlknG~~dIk~H~wF~~v~W~~i  308 (355)
T KOG0616|consen  256 GKVKFP-----SYFSSDAKDLLKKLLQVDLTKRF----------------------GNLKNGVEDIKNHPWFKGVDWEAI  308 (355)
T ss_pred             CcccCC-----cccCHHHHHHHHHHHhhhhHhhh----------------------cCcCCCccccccCcccccccHHHH
Confidence            876665     67899999999999999988774                      333 48999999999998888777


Q ss_pred             HHHHhhhcCCC
Q psy3574         232 AIELLQKVSNP  242 (302)
Q Consensus       232 ~~~~~~~~~~~  242 (302)
                      ....++....|
T Consensus       309 ~~r~ie~P~~p  319 (355)
T KOG0616|consen  309 LQRKIEPPFEP  319 (355)
T ss_pred             hhccccCCCCC
Confidence            65554444433



>KOG0598|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG3741|consensus Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1826|consensus Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG2268|consensus Back     alignment and domain information
>KOG1235|consensus Back     alignment and domain information
>KOG1093|consensus Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>KOG2270|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 3e-32
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 3e-32
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 1e-31
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 6e-31
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 2e-30
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 2e-30
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 4e-30
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 6e-30
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 1e-29
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 1e-28
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 5e-28
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 7e-28
3a7f_A303 Human Mst3 Kinase Length = 303 1e-27
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-27
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 7e-25
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 7e-25
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 1e-24
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 2e-24
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 2e-24
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 2e-24
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 4e-24
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 2e-22
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 7e-22
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 5e-21
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 5e-21
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 3e-20
4fie_A423 Full-Length Human Pak4 Length = 423 3e-20
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 3e-20
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 3e-20
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 3e-20
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 4e-20
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 4e-14
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 3e-13
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 2e-11
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 3e-11
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 6e-11
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 1e-10
3kk9_A282 Camkii Substrate Complex B Length = 282 1e-10
3kk8_A284 Camkii Substrate Complex A Length = 284 1e-10
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 2e-10
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 2e-10
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 2e-10
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 4e-10
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 5e-10
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 5e-10
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 6e-10
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 7e-10
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 7e-10
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 1e-09
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 2e-09
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 2e-09
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 2e-09
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 2e-09
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 3e-09
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 4e-09
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 7e-09
3soa_A444 Full-Length Human Camkii Length = 444 7e-09
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 8e-09
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 8e-09
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 8e-09
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 9e-09
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 1e-08
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 1e-08
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 1e-08
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 1e-08
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 2e-08
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 2e-08
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 2e-08
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 3e-08
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 3e-08
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-08
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 3e-08
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 5e-08
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 5e-08
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 5e-08
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 6e-08
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 6e-08
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 6e-08
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 6e-08
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 6e-08
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 7e-08
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 7e-08
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 8e-08
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 1e-07
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 1e-07
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 1e-07
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 2e-07
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 2e-07
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-07
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 3e-07
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 3e-07
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-07
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-07
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 3e-07
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 3e-07
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 4e-07
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 5e-07
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 5e-07
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 7e-07
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 7e-07
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 7e-07
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 8e-07
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 8e-07
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 8e-07
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 8e-07
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 8e-07
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 8e-07
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 8e-07
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 9e-07
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 9e-07
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 1e-06
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 1e-06
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 1e-06
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 1e-06
1smh_A350 Protein Kinase A Variant Complex With Completely Or 1e-06
3bhy_A283 Crystal Structure Of Human Death Associated Protein 2e-06
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 2e-06
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 2e-06
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 2e-06
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 2e-06
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 2e-06
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 2e-06
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 2e-06
4ae9_A343 Structure And Function Of The Human Sperm-specific 2e-06
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 2e-06
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 2e-06
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 2e-06
4h58_A275 Braf In Complex With Compound 3 Length = 275 2e-06
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 2e-06
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 2e-06
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 2e-06
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 2e-06
4ae6_A343 Structure And Function Of The Human Sperm-specific 2e-06
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 2e-06
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 2e-06
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 2e-06
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 2e-06
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 2e-06
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 2e-06
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 2e-06
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 2e-06
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 2e-06
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 2e-06
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 2e-06
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 2e-06
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 2e-06
2qcs_A350 A Complex Structure Between The Catalytic And Regul 2e-06
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 2e-06
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 2e-06
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 2e-06
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-06
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 2e-06
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-06
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 2e-06
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 2e-06
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 2e-06
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 2e-06
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 2e-06
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 2e-06
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 2e-06
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 2e-06
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 2e-06
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 3e-06
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 3e-06
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 3e-06
3g51_A325 Structural Diversity Of The Active Conformation Of 3e-06
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-06
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-06
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 3e-06
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 3e-06
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 4e-06
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 4e-06
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 4e-06
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 4e-06
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 4e-06
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 4e-06
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 4e-06
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 4e-06
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 4e-06
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 4e-06
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 4e-06
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 4e-06
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 5e-06
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 5e-06
3f5u_A295 Crystal Structure Of The Death Associated Protein K 5e-06
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-06
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 5e-06
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-06
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-06
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 5e-06
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 5e-06
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 5e-06
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 6e-06
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-06
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 7e-06
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 8e-06
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 8e-06
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 9e-06
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 9e-06
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 9e-06
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 9e-06
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 9e-06
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 9e-06
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 1e-05
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 1e-05
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 1e-05
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 1e-05
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 1e-05
2oza_A356 Structure Of P38alpha Complex Length = 356 1e-05
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 1e-05
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 1e-05
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 1e-05
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 1e-05
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 1e-05
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 1e-05
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 1e-05
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 1e-05
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 1e-05
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 1e-05
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 1e-05
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 1e-05
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 1e-05
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 2e-05
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-05
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 2e-05
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 2e-05
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 2e-05
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 2e-05
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-05
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 2e-05
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 3e-05
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 3e-05
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 3e-05
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-05
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 3e-05
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-05
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 3e-05
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 3e-05
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 3e-05
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 3e-05
2wtk_B373 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 4e-05
3gni_B389 Structure Of Strad And Mo25 Length = 389 4e-05
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 4e-05
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 5e-05
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 5e-05
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 5e-05
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 5e-05
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 5e-05
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 6e-05
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 6e-05
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 7e-05
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 8e-05
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 8e-05
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 9e-05
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 9e-05
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 9e-05
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 1e-04
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 1e-04
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-04
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-04
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 1e-04
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 1e-04
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 1e-04
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 1e-04
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 1e-04
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 2e-04
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 2e-04
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 2e-04
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 2e-04
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 2e-04
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 2e-04
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 2e-04
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 2e-04
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 2e-04
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 2e-04
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 2e-04
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 2e-04
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 3e-04
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 3e-04
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 3e-04
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 3e-04
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 3e-04
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 3e-04
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 3e-04
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 3e-04
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 3e-04
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 3e-04
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 3e-04
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 4e-04
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 4e-04
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 4e-04
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 6e-04
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 6e-04
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 6e-04
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 6e-04
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 6e-04
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 6e-04
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 6e-04
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 7e-04
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 7e-04
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 7e-04
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 7e-04
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 7e-04
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 7e-04
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 7e-04
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 7e-04
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 7e-04
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 8e-04
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 8e-04
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 8e-04
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 9e-04
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 9e-04
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 9e-04
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure

Iteration: 1

Score = 135 bits (340), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 65/124 (52%), Positives = 89/124 (71%), Gaps = 4/124 (3%) Query: 72 GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVE--RKGGYNQQCDIWAVGITAI 129 GD++LADFGVSA+ T+ KR SFIGTPYWMAPEV E + Y+ + DIW++GIT I Sbjct: 154 GDIRLADFGVSAKNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLI 213 Query: 130 ELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTAD 189 E+A+++PP +L+PMR L ++KS PP L +WS F +F+KIAL KNP+ RP+A Sbjct: 214 EMAQIEPPHHELNPMRVLLKIAKS--DPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAA 271 Query: 190 KLLQ 193 +LL+ Sbjct: 272 QLLE 275
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|2WTK|B Chain B, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 373 Back     alignment and structure
>pdb|3GNI|B Chain B, Structure Of Strad And Mo25 Length = 389 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-73
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 4e-23
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 2e-72
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 2e-22
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 5e-70
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 4e-22
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 7e-69
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 5e-24
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 1e-68
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 3e-21
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-68
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 3e-21
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-68
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-22
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 7e-63
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 5e-20
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 7e-55
3aln_A327 Dual specificity mitogen-activated protein kinase; 4e-52
3aln_A327 Dual specificity mitogen-activated protein kinase; 2e-12
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-51
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-11
3fme_A290 Dual specificity mitogen-activated protein kinase; 2e-47
3fme_A290 Dual specificity mitogen-activated protein kinase; 4e-10
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-46
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 8e-12
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-45
3an0_A340 Dual specificity mitogen-activated protein kinase; 8e-10
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-42
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 5e-09
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-41
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-12
3eqc_A360 Dual specificity mitogen-activated protein kinase; 6e-39
3eqc_A360 Dual specificity mitogen-activated protein kinase; 1e-05
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 6e-38
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-06
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 1e-37
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 1e-07
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 9e-36
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-07
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-34
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 7e-06
2a19_B284 Interferon-induced, double-stranded RNA-activated 7e-33
2a19_B284 Interferon-induced, double-stranded RNA-activated 8e-05
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-30
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 4e-04
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 3e-30
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 5e-04
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 6e-30
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 4e-04
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 8e-27
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 7e-26
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 9e-26
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 3e-23
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 5e-23
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-22
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-19
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 1e-17
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 1e-17
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-17
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-17
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 4e-17
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 6e-17
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 6e-17
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 7e-17
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 9e-17
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-16
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-16
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-16
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-16
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 2e-16
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 2e-16
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 3e-16
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 3e-16
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 3e-16
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 4e-16
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 4e-16
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 4e-16
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 6e-16
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 9e-16
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-15
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 3e-15
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 3e-15
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 4e-15
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 5e-15
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 5e-15
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 5e-15
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 8e-15
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-14
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-14
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 1e-14
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 2e-14
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-14
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 2e-14
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 2e-14
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-14
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 3e-14
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 5e-14
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 7e-14
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 7e-14
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-13
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-13
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-13
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-13
2y0a_A326 Death-associated protein kinase 1; transferase, ca 2e-13
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 3e-13
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 3e-13
3bhy_A283 Death-associated protein kinase 3; death associate 4e-13
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 4e-13
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 6e-13
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 6e-13
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-12
3q4u_A301 Activin receptor type-1; structural genomics conso 1e-12
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 2e-12
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-12
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 3e-12
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-12
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 4e-12
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 5e-12
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 6e-12
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 6e-12
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 1e-11
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-11
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 3e-11
3soc_A322 Activin receptor type-2A; structural genomics cons 5e-11
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 7e-11
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 8e-11
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 1e-10
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 1e-10
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 2e-10
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 2e-10
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 3e-10
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 3e-10
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 4e-10
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 4e-10
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 5e-10
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 9e-10
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 1e-09
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-09
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 5e-09
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 7e-09
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 1e-08
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-08
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-08
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 3e-08
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 4e-08
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 5e-08
2eue_A275 Carbon catabolite derepressing protein kinase; kin 9e-08
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 9e-08
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 1e-07
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-07
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 3e-07
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 4e-07
3dls_A335 PAS domain-containing serine/threonine-protein KI; 9e-07
3ork_A311 Serine/threonine protein kinase; structural genomi 3e-06
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 4e-06
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-05
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 2e-05
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-05
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 2e-05
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 4e-05
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 4e-05
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 5e-05
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-04
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 1e-04
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-04
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-04
3lzb_A327 Epidermal growth factor receptor; epidermal growth 3e-04
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 3e-04
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 4e-04
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 5e-04
3poz_A327 Epidermal growth factor receptor; kinase domain, a 7e-04
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
 Score =  227 bits (580), Expect = 2e-73
 Identities = 68/184 (36%), Positives = 101/184 (54%), Gaps = 31/184 (16%)

Query: 72  GDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIEL 131
           G  KLADFGV+ Q+T T+ KR + IGTP+WMAPEV    ++ GYN   DIW++GITAIE+
Sbjct: 162 GHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI---QEIGYNCVADIWSLGITAIEM 218

Query: 132 AELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKL 191
           AE +PP  D+HPMRA+F++  +   PP  +  + WS  F +FVK  L K+P++R TA +L
Sbjct: 219 AEGKPPYADIHPMRAIFMIPTNP--PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQL 276

Query: 192 LQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKVSNPPTTYTDLEP 251
           LQ                          HPF +      +  +L+ +  +      + + 
Sbjct: 277 LQ--------------------------HPFVRSAKGVSILRDLINEAMDVKLKRQESQQ 310

Query: 252 DDDG 255
            ++G
Sbjct: 311 REEG 314


>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.98
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.98
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.98
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.98
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.98
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.98
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.98
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.98
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.98
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.97
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.97
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.97
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.97
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.97
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.97
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.97
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.97
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.97
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.97
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.97
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.97
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.96
3uqc_A286 Probable conserved transmembrane protein; structur 99.94
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.93
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.72
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.52
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.17
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.73
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 97.67
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.54
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 97.27
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 97.0
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 96.96
3r70_A320 Aminoglycoside phosphotransferase; structural geno 96.5
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 93.63
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 90.86
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 89.16
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 85.48
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=100.00  E-value=2.7e-51  Score=355.29  Aligned_cols=199  Identities=16%  Similarity=0.240  Sum_probs=175.8

Q ss_pred             Cchhhhcch----heeEEEecCCcchHHHHHHhccccccccccchhHHHhhHHHHHHHHHhCCCCCCCCcC----CCCCC
Q psy3574           1 MSRVFNHFL----QVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKD----KDRCG   72 (302)
Q Consensus         1 iv~~~~~~~----~~iv~E~~~~g~L~~~~~~~~~~~~~l~~~~~~~i~~qi~~aL~~lH~~~i~Hrdlkp----~~~~~   72 (302)
                      ||++|+.|.    +|||||||+||+|. +++...+   .++|.+++.+++||+.||+|||++||+||||||    ++.+|
T Consensus        94 Iv~l~~~~~~~~~~yivmEy~~gG~L~-~~i~~~~---~l~e~~~~~~~~qi~~al~ylH~~~IiHRDlKPeNILl~~~g  169 (311)
T 4aw0_A           94 FVKLYFTFQDDEKLYFGLSYAKNGELL-KYIRKIG---SFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDM  169 (311)
T ss_dssp             BCCEEEEEECSSEEEEEECCCTTEEHH-HHHHHHS---SCCHHHHHHHHHHHHHHHHHHHHTTEECSCCSGGGEEECTTS
T ss_pred             CCeEEEEEEeCCEEEEEEecCCCCCHH-HHHHHcC---CCCHHHHHHHHHHHHHHHHHHHHCCCccCCCCHHHeEEcCCC
Confidence            688998887    59999999999999 8887777   799999999999999999999999999999999    88999


Q ss_pred             CEEEecccccccccccc--ccccccccCcccchhhcccccccCCCCchhhHHHHHHHHHHHHhCCCCCCCCChHHHHHHH
Q psy3574          73 DVKLADFGVSAQITATI--NKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLM  150 (302)
Q Consensus        73 ~ikL~DFg~a~~~~~~~--~~~~~~~gt~~y~aPE~~~~~~~~~~~~~~DiwslG~il~ell~g~~pf~~~~~~~~~~~i  150 (302)
                      ++||+|||+|+.+....  ....+.+||+.|||||++.   +..|+.++|||||||++|+|++|++||.+.+......++
T Consensus       170 ~vKl~DFGla~~~~~~~~~~~~~~~~GTp~YmAPEvl~---~~~y~~~~DiWSlGvilyeml~G~~PF~~~~~~~~~~~i  246 (311)
T 4aw0_A          170 HIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLT---EKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKI  246 (311)
T ss_dssp             CEEECCCTTCEECCTTTTCCCBCCCCSCGGGCCHHHHH---HSCBCHHHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHH
T ss_pred             CEEEEEcCCceecCCCCCcccccCcccCcccCCHHHHc---CCCCCcHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHH
Confidence            99999999998875432  3345779999999999996   677999999999999999999999999999999988888


Q ss_pred             HhcCCCCCCCCCCCCCCHHHHHHHHHhhhcCCCCCCCHHHHHHHHHHHhHHHHHHhhhCCCCCCccccCCCccccchhhH
Q psy3574         151 SKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKR  230 (302)
Q Consensus       151 ~~~~~~~~~~~~~~~~s~~~~~li~~~L~~dp~~R~t~~~ll~~l~~~~~~~~~~~~~~~~~~~~~i~~hp~f~~~~~~~  230 (302)
                      .......     +..+++++++||.+||+.||++|||++|++.+.|++.                    ||||++.+|..
T Consensus       247 ~~~~~~~-----p~~~s~~~~dli~~lL~~dp~~R~t~~e~~~~~~i~~--------------------Hp~F~~idw~~  301 (311)
T 4aw0_A          247 IKLEYDF-----PEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKA--------------------HPFFESVTWEN  301 (311)
T ss_dssp             HHTCCCC-----CTTCCHHHHHHHHHHSCSSGGGSTTSGGGTCHHHHHT--------------------SGGGTTCCCTT
T ss_pred             HcCCCCC-----CcccCHHHHHHHHHHccCCHhHCcChHHHcCCHHHHC--------------------CCCcCCCCHHH
Confidence            8876543     3568999999999999999999999999876555544                    99999888765


Q ss_pred             H
Q psy3574         231 V  231 (302)
Q Consensus       231 ~  231 (302)
                      +
T Consensus       302 l  302 (311)
T 4aw0_A          302 L  302 (311)
T ss_dssp             G
T ss_pred             h
Confidence            4



>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 302
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-30
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-05
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-28
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-04
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 4e-27
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 8e-06
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-26
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-06
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-26
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-05
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 5e-26
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 8e-05
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 5e-25
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 5e-04
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-22
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 0.003
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-22
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-04
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 6e-22
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-04
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-21
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 0.002
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-21
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 3e-21
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-04
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-20
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-20
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 0.003
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-20
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-04
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 6e-20
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 0.003
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 7e-20
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-19
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-04
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-19
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 7e-04
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-18
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-18
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-18
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-18
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 9e-18
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-17
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 0.003
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-17
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 9e-05
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 3e-17
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 4e-17
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-17
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 8e-17
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 8e-17
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 9e-17
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-16
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-16
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-16
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-16
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-16
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 5e-16
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-16
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 6e-16
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 0.003
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 7e-16
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-15
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 6e-04
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-15
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 5e-15
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 5e-15
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-14
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-14
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-14
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-14
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 4e-14
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-14
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-13
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 0.004
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-13
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-13
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 8e-13
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-12
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-11
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 5e-10
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 7e-10
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-09
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-05
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: STE20-like serine/threonine-protein kinase, SLK
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  113 bits (285), Expect = 2e-30
 Identities = 71/163 (43%), Positives = 92/163 (56%), Gaps = 30/163 (18%)

Query: 69  DRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVE--RKGGYNQQCDIWAVGI 126
              GD+KLADFGVSA+ T TI +R SFIGTPYWMAPEV   E  +   Y+ + D+W++GI
Sbjct: 144 TLDGDIKLADFGVSAKNTRTIQRRDSFIGTPYWMAPEVVMCETSKDRPYDYKADVWSLGI 203

Query: 127 TAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRP 186
           T IE+AE++PP  +L+PMR L  ++KS  +PP L    RWSS F +F+K  L KN   R 
Sbjct: 204 TLIEMAEIEPPHHELNPMRVLLKIAKS--EPPTLAQPSRWSSNFKDFLKKCLEKNVDARW 261

Query: 187 TADKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSK 229
           T  +LLQ                          HPF   D +K
Sbjct: 262 TTSQLLQ--------------------------HPFVTVDSNK 278


>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.97
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.47
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 82.91
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.7e-47  Score=326.26  Aligned_cols=183  Identities=34%  Similarity=0.583  Sum_probs=161.5

Q ss_pred             Cchhhhcch----heeEEEecCCcchHHHHHHhccccccccccchhHHHhhHHHHHHHHHhCCCCCCCCcC----CCCCC
Q psy3574           1 MSRVFNHFL----QVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKD----KDRCG   72 (302)
Q Consensus         1 iv~~~~~~~----~~iv~E~~~~g~L~~~~~~~~~~~~~l~~~~~~~i~~qi~~aL~~lH~~~i~Hrdlkp----~~~~~   72 (302)
                      ||++|+.|.    +|||||||+||+|. +++..+    .+++.+++.+++||+.||.|||++||+||||||    ++.+|
T Consensus        79 Iv~~~~~~~~~~~~~ivmEy~~gg~L~-~~~~~~----~l~~~~~~~i~~qi~~aL~yLH~~~iiHrDiKp~NILl~~~~  153 (293)
T d1yhwa1          79 IVNYLDSYLVGDELWVVMEYLAGGSLT-DVVTET----CMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDG  153 (293)
T ss_dssp             BCCEEEEEEETTEEEEEEECCTTCBHH-HHHHHS----CCCHHHHHHHHHHHHHHHHHHHHTTEECCCCSGGGEEECTTC
T ss_pred             EeeEeEEEEECCEEEEEEEecCCCcHH-HHhhcc----CCCHHHHHHHHHHHHHHHHHHHHCCCcccCCcHHHeEECCCC
Confidence            688888776    58999999999999 776654    599999999999999999999999999999999    88889


Q ss_pred             CEEEeccccccccccccccccccccCcccchhhcccccccCCCCchhhHHHHHHHHHHHHhCCCCCCCCChHHHHHHHHh
Q psy3574          73 DVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSK  152 (302)
Q Consensus        73 ~ikL~DFg~a~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~~~~DiwslG~il~ell~g~~pf~~~~~~~~~~~i~~  152 (302)
                      ++||+|||+|+.+..........+||+.|+|||++.   +..|+.++||||+||++|+|++|..||.+.+.......+..
T Consensus       154 ~vkl~DFG~a~~~~~~~~~~~~~~gt~~Y~aPE~~~---~~~~~~~~DiwSlGvilyemltG~~Pf~~~~~~~~~~~~~~  230 (293)
T d1yhwa1         154 SVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVT---RKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIAT  230 (293)
T ss_dssp             CEEECCCTTCEECCSTTCCBCCCCSCGGGCCHHHHS---SSCBCTHHHHHHHHHHHHHHHHSSCTTTTSCHHHHHHHHHH
T ss_pred             cEeeccchhheeeccccccccccccCCCccChhhhc---CCCCCchhceehHhHHHHHHhhCCCCCCCCCHHHHHHHHHh
Confidence            999999999998766545556778999999999996   66789999999999999999999999999888888777766


Q ss_pred             cCCCCCCCCCCCCCCHHHHHHHHHhhhcCCCCCCCHHHHHH
Q psy3574         153 SGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQ  193 (302)
Q Consensus       153 ~~~~~~~~~~~~~~s~~~~~li~~~L~~dp~~R~t~~~ll~  193 (302)
                      ...  +....+..++..+++||.+||..||.+|||+.++|+
T Consensus       231 ~~~--~~~~~~~~~s~~~~~li~~~L~~dP~~R~s~~eil~  269 (293)
T d1yhwa1         231 NGT--PELQNPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQ  269 (293)
T ss_dssp             HCS--CCCSSGGGSCHHHHHHHHHHTCSSTTTSCCHHHHTT
T ss_pred             CCC--CCCCCcccCCHHHHHHHHHHccCChhHCcCHHHHhc
Confidence            543  233445678999999999999999999999999999



>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure