Diaphorina citri psyllid: psy3574

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--

MSRVFNHFLQVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGYNQQCDIWAHPFFKYDMSKRVAIELLQKVSNPPTTYTDLEPDDDGEIPNVPQRIQSRLLTARNNHARNPNIDESEVFSLPDVSAPWNSTLST

ccEEcccccccEEEEEccccccccccEEEcccccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEECcEEHHHcHHHHccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccEEEEccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccc

MSRVFNHFLQVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPALKDKDRCGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGGYNQQCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFK**ALKDKDRWSSTFHNFVKIALTKNPKKRPTADKLLQVILIHRARVAAVERKGGYNQQCDIWA********SKR****LLQ*V***************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitogen-activated protein kinase kinase kinase kinase 3	May play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.	confident	Q8IVH8
Mitogen-activated protein kinase kinase kinase kinase 3	May play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.	confident	Q99JP0
Mitogen-activated protein kinase kinase kinase kinase 3	May play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.	confident	Q924I2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004672 [MF]	protein kinase activity	confident	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0007254 [BP]	JNK cascade	confident	GO:0065007, GO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0000165, GO:0031098, GO:0050794, GO:0008150, GO:0006950, GO:0051403, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0006915 [BP]	apoptotic process	confident	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005737 [CC]	cytoplasm	confident	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0006903 [BP]	vesicle targeting	probable	GO:0009987, GO:0016192, GO:0051234, GO:0006810, GO:0051179, GO:0044763, GO:0051640, GO:0051648, GO:0051649, GO:0008150, GO:0051656, GO:0051650, GO:0044699, GO:0051641
GO:0046330 [BP]	positive regulation of JNK cascade	probable	GO:0048584, GO:0048583, GO:0023056, GO:0023051, GO:0046328, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043408, GO:0009966, GO:0009967, GO:0065007, GO:0048518, GO:0010740, GO:0070302, GO:0070304, GO:0050794, GO:0043410, GO:0008150, GO:0032874, GO:0032872, GO:0080134, GO:0080135, GO:0048522
GO:0032008 [BP]	positive regulation of TOR signaling cascade	probable	GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0008150, GO:0023051, GO:0048518, GO:0032006, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0048149 [BP]	behavioral response to ethanol	probable	GO:1901700, GO:0030534, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0045471, GO:0008150, GO:0042221, GO:0097305, GO:0010033, GO:0044699
GO:0043065 [BP]	positive regulation of apoptotic process	probable	GO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0008361 [BP]	regulation of cell size	probable	GO:0071840, GO:0009987, GO:0016043, GO:0090066, GO:0065007, GO:0044763, GO:0032535, GO:0008150, GO:0065008, GO:0044699
GO:0007030 [BP]	Golgi organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0046626 [BP]	regulation of insulin receptor signaling pathway	probable	GO:0009966, GO:1900076, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0031931 [CC]	TORC1 complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0007257 [BP]	activation of JUN kinase activity	probable	GO:0000187, GO:0080135, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0051247, GO:0023056, GO:0043406, GO:0043405, GO:0051174, GO:0007165, GO:0046328, GO:0043506, GO:0071902, GO:0035556, GO:0071900, GO:0010627, GO:0010647, GO:0043085, GO:0043408, GO:0007254, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0000165, GO:0031098, GO:0050789, GO:0023051, GO:0060255, GO:0032268, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0042325, GO:0050790, GO:0045937, GO:0044700, GO:0070302, GO:0031323, GO:0045859, GO:0080090, GO:0051716, GO:0050794, GO:0032872, GO:0006950, GO:0051403, GO:0044763, GO:0023052, GO:0007154, GO:0043507, GO:0043410, GO:0042327, GO:0001932, GO:0007243, GO:0050896, GO:0031401, GO:0051338, GO:0080134, GO:0033554, GO:0008150, GO:0009987, GO:0045860, GO:0001934, GO:0048522
GO:0042059 [BP]	negative regulation of epidermal growth factor receptor signaling pathway	probable	GO:0010646, GO:0009968, GO:0050794, GO:0009966, GO:0048585, GO:0048583, GO:0042058, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:1901184, GO:1901185, GO:0050789, GO:0048523
GO:0040009 [BP]	regulation of growth rate	probable	GO:0008150, GO:0040008, GO:0065007, GO:0050789
GO:0070328 [BP]	triglyceride homeostasis	probable	GO:0042592, GO:0048878, GO:0055088, GO:0065007, GO:0008150, GO:0065008, GO:0055090
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0018105 [BP]	peptidyl-serine phosphorylation	probable	GO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0048856 [BP]	anatomical structure development	probable	GO:0032502, GO:0008150
GO:0031435 [MF]	mitogen-activated protein kinase kinase kinase binding	probable	GO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0032154 [CC]	cleavage furrow	probable	GO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0006955 [BP]	immune response	probable	GO:0002376, GO:0050896, GO:0008150
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0015629 [CC]	actin cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005083 [MF]	small GTPase regulator activity	probable	GO:0030695, GO:0030234, GO:0060589, GO:0003674
GO:0008349 [MF]	MAP kinase kinase kinase kinase activity	probable	GO:0016301, GO:0004674, GO:0016773, GO:0005057, GO:0003824, GO:0004702, GO:0060089, GO:0016740, GO:0003674, GO:0004871, GO:0004672, GO:0016772

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3COM, chain A
Confidence level:very confident
Coverage over the Query: 1-193,220-239
View the alignment between query and template
View the model in PyMOL

Template: 3KEX, chain A
Confidence level:confident
Coverage over the Query: 1-225
View the alignment between query and template
View the model in PyMOL

Template: 4APC, chain A
Confidence level:confident
Coverage over the Query: 69-223
View the alignment between query and template
View the model in PyMOL