Diaphorina citri psyllid: psy3587

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----

VVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQYLSKQGVSKHSRPAVRRSTK

cEEEccccccccccccEEccccCEECcccccccccccccccccEEccccccccccEEEEEEcccEEEECcccEEcccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccCEEECcccccccccccccccccHHccccc

***********KHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQY*******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

VVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQYLSKQGVSKHSRPAVRRSTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Guanine nucleotide-binding protein-like 1	Possible regulatory or functional link with the histocompatibility cluster.	confident	P36915
Guanine nucleotide-binding protein-like 1	Possible regulatory or functional link with the histocompatibility cluster.	confident	P36916
Guanine nucleotide-binding protein-like 1	Possible regulatory or functional link with the histocompatibility cluster.	confident	Q5RA07

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0006974 [BP]	response to DNA damage stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CNL, chain A
Confidence level:probable
Coverage over the Query: 54-169
View the alignment between query and template
View the model in PyMOL