Psyllid ID: psy3587


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
VVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQYLSKQGVSKHSRPAVRRSTK
cEEEccccccccccccEEccccEEEEcccccccccccccccccEEccccccccccEEEEEEcccEEEEEcccEEcccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHcccc
cEEEEccccccccEEEEEEccccccccccccccccccccccEEEEEcccccccEEEEEEEEcccEEEEccccEEccccccHHHHHHccEEEHHHHccccccHHHHHHcccHHHEEEEccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccEEEcccccccccccccccccccHccccc
vvsvsrtpghtkhfqtifltdnirlcdcpglvfpskvpkplqvvsvsrtpghtkhfqtifltdnirlcdcpglvfpskvpkplqvlmgsfpiaqlrepysTVQYLAERMDLIKLLhikhpdddeywcamdicdgwaqkRSYMtaktgrydsYRAANELLRMATEGriclclmppqylskqgvskhsrpavrrstk
vvsvsrtpghtkhfqtifltdnirLCDCPGLVFPSKVPKPLQVVSvsrtpghtKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMppqylskqgvskhsrpavrrstk
VVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQYLSKQGVSKHSRPAVRRSTK
***********KHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQYL******************
***************TIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQ********************
********GHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQYL******************
VVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQY*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTVQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLMPPQYLSKQGVSKHSRPAVRRSTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query195 2.2.26 [Sep-21-2011]
P36916607 Guanine nucleotide-bindin yes N/A 0.723 0.232 0.568 1e-46
Q5RA07607 Guanine nucleotide-bindin yes N/A 0.723 0.232 0.568 2e-46
Q7YR35607 Guanine nucleotide-bindin yes N/A 0.723 0.232 0.568 2e-46
P36915607 Guanine nucleotide-bindin yes N/A 0.723 0.232 0.568 2e-46
Q5TM59607 Guanine nucleotide-bindin yes N/A 0.723 0.232 0.568 2e-46
Q4R8D2607 Guanine nucleotide-bindin N/A N/A 0.723 0.232 0.568 2e-46
Q6MG06607 Guanine nucleotide-bindin yes N/A 0.723 0.232 0.561 9e-46
P53145 640 Large subunit GTPase 1 OS yes N/A 0.682 0.207 0.4 1e-17
Q10190 616 Large subunit GTPase 1 OS yes N/A 0.682 0.215 0.384 3e-15
Q9W590606 Large subunit GTPase 1 ho no N/A 0.630 0.202 0.351 7e-14
>sp|P36916|GNL1_MOUSE Guanine nucleotide-binding protein-like 1 OS=Mus musculus GN=Gnl1 PE=1 SV=4 Back     alignment and function desciption
 Score =  185 bits (470), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 83/146 (56%), Positives = 111/146 (76%), Gaps = 5/146 (3%)

Query: 42  QVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYST 101
           +VVSVSRTPGHT++FQT FLT +++LCDCPGL+FPS +P+ LQVL G +PIAQ++EPY++
Sbjct: 384 KVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSLLPRQLQVLAGIYPIAQIQEPYTS 443

Query: 102 VQYLAERMDLIKLLHIKHPDDDE-----YWCAMDICDGWAQKRSYMTAKTGRYDSYRAAN 156
           V YLA R+ +  LLH++HP+ ++      WCA DIC+ WA+KR Y TAK  R D YRAAN
Sbjct: 444 VGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAAN 503

Query: 157 ELLRMATEGRICLCLMPPQYLSKQGV 182
            LLR+A +GR+ LC  PP Y  ++G 
Sbjct: 504 SLLRLAVDGRLSLCFYPPGYSEQRGT 529




Possible regulatory or functional link with the histocompatibility cluster.
Mus musculus (taxid: 10090)
>sp|Q5RA07|GNL1_PONAB Guanine nucleotide-binding protein-like 1 OS=Pongo abelii GN=GNL1 PE=2 SV=1 Back     alignment and function description
>sp|Q7YR35|GNL1_PANTR Guanine nucleotide-binding protein-like 1 OS=Pan troglodytes GN=GNL1 PE=3 SV=3 Back     alignment and function description
>sp|P36915|GNL1_HUMAN Guanine nucleotide-binding protein-like 1 OS=Homo sapiens GN=GNL1 PE=1 SV=2 Back     alignment and function description
>sp|Q5TM59|GNL1_MACMU Guanine nucleotide-binding protein-like 1 OS=Macaca mulatta GN=GNL1 PE=3 SV=1 Back     alignment and function description
>sp|Q4R8D2|GNL1_MACFA Guanine nucleotide-binding protein-like 1 OS=Macaca fascicularis GN=GNL1 PE=2 SV=1 Back     alignment and function description
>sp|Q6MG06|GNL1_RAT Guanine nucleotide-binding protein-like 1 OS=Rattus norvegicus GN=Gnl1 PE=2 SV=1 Back     alignment and function description
>sp|P53145|LSG1_YEAST Large subunit GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSG1 PE=1 SV=1 Back     alignment and function description
>sp|Q10190|LSG1_SCHPO Large subunit GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsg1 PE=3 SV=1 Back     alignment and function description
>sp|Q9W590|LSG1_DROME Large subunit GTPase 1 homolog OS=Drosophila melanogaster GN=ns3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
189235276 1234 PREDICTED: similar to mmr1/hsr1 GTP bind 0.712 0.112 0.748 1e-60
270004156 584 hypothetical protein TcasGA2_TC003476 [T 0.712 0.238 0.748 2e-60
383855489 577 PREDICTED: guanine nucleotide-binding pr 0.774 0.261 0.664 2e-56
340729193 585 PREDICTED: guanine nucleotide-binding pr 0.748 0.249 0.666 2e-55
380017144 583 PREDICTED: guanine nucleotide-binding pr 0.774 0.259 0.638 1e-54
307168068 570 Guanine nucleotide-binding protein-like 0.774 0.264 0.664 2e-54
110757680 583 PREDICTED: nucleostemin 4 [Apis mellifer 0.774 0.259 0.638 3e-54
350416844 589 PREDICTED: guanine nucleotide-binding pr 0.738 0.244 0.662 9e-54
345488722 578 PREDICTED: guanine nucleotide-binding pr 0.758 0.256 0.651 2e-53
357610504 471 putative mmr1/hsr1 GTP binding protein [ 0.682 0.282 0.691 6e-53
>gi|189235276|ref|XP_973489.2| PREDICTED: similar to mmr1/hsr1 GTP binding protein [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 125/139 (89%)

Query: 42   QVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYST 101
            +VVSVSRTPGHTKHFQTIFLT N+RLCDCPGLVFPSK PK +QVLMGSFPIAQLREP++T
Sbjct: 1014 KVVSVSRTPGHTKHFQTIFLTPNVRLCDCPGLVFPSKTPKVIQVLMGSFPIAQLREPFTT 1073

Query: 102  VQYLAERMDLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRM 161
            ++YLAERMDL  +L I+HP++D+ WCAMDICDGWA+KR ++TAK  R DSYRAAN+LLRM
Sbjct: 1074 IKYLAERMDLPNMLRIEHPENDDTWCAMDICDGWAKKRGFLTAKAARLDSYRAANDLLRM 1133

Query: 162  ATEGRICLCLMPPQYLSKQ 180
            A +G+ICLCL PP+Y +K+
Sbjct: 1134 ALDGKICLCLRPPKYSNKK 1152




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270004156|gb|EFA00604.1| hypothetical protein TcasGA2_TC003476 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383855489|ref|XP_003703243.1| PREDICTED: guanine nucleotide-binding protein-like 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340729193|ref|XP_003402891.1| PREDICTED: guanine nucleotide-binding protein-like 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380017144|ref|XP_003692522.1| PREDICTED: guanine nucleotide-binding protein-like 1-like [Apis florea] Back     alignment and taxonomy information
>gi|307168068|gb|EFN61374.1| Guanine nucleotide-binding protein-like 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|110757680|ref|XP_396436.3| PREDICTED: nucleostemin 4 [Apis mellifera] Back     alignment and taxonomy information
>gi|350416844|ref|XP_003491131.1| PREDICTED: guanine nucleotide-binding protein-like 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345488722|ref|XP_001605060.2| PREDICTED: guanine nucleotide-binding protein-like 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357610504|gb|EHJ67009.1| putative mmr1/hsr1 GTP binding protein [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
MGI|MGI:95764607 Gnl1 "guanine nucleotide bindi 0.758 0.243 0.564 1.2e-44
UNIPROTKB|A8MPZ0262 GNL1 "cDNA FLJ53828, highly si 0.717 0.534 0.586 2.4e-44
UNIPROTKB|B0V0L0407 GNL1 "Guanine nucleotide-bindi 0.717 0.343 0.586 2.4e-44
UNIPROTKB|B4DWZ0404 GNL1 "cDNA FLJ52448, moderatel 0.717 0.346 0.586 2.4e-44
UNIPROTKB|E7ETJ1429 GNL1 "Guanine nucleotide-bindi 0.717 0.326 0.586 2.4e-44
UNIPROTKB|P36915607 GNL1 "Guanine nucleotide-bindi 0.717 0.230 0.586 2.4e-44
UNIPROTKB|Q5TM59607 GNL1 "Guanine nucleotide-bindi 0.717 0.230 0.586 2.4e-44
UNIPROTKB|Q7YR35607 GNL1 "Guanine nucleotide-bindi 0.717 0.230 0.586 2.4e-44
UNIPROTKB|I7GF95607 GNL1 "Uncharacterized protein" 0.717 0.230 0.586 3.1e-44
RGD|1303051607 Gnl1 "guanine nucleotide bindi 0.758 0.243 0.558 3.1e-44
MGI|MGI:95764 Gnl1 "guanine nucleotide binding protein-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 470 (170.5 bits), Expect = 1.2e-44, P = 1.2e-44
 Identities = 87/154 (56%), Positives = 115/154 (74%)

Query:    42 QVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYST 101
             +VVSVSRTPGHT++FQT FLT +++LCDCPGL+FPS +P+ LQVL G +PIAQ++EPY++
Sbjct:   384 KVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSLLPRQLQVLAGIYPIAQIQEPYTS 443

Query:   102 VQYLAERMDLIKLLHIKHPD-DD---EY-WCAMDICDGWAQKRSYMTAKTGRYDSYRAAN 156
             V YLA R+ +  LLH++HP+ +D   E+ WCA DIC+ WA+KR Y TAK  R D YRAAN
Sbjct:   444 VGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAAN 503

Query:   157 ELLRMATEGRICLCLMPPQYLSKQGV-SKHSRPA 189
              LLR+A +GR+ LC  PP Y  ++G    H   A
Sbjct:   504 SLLRLAVDGRLSLCFYPPGYSEQRGTWESHPETA 537


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003924 "GTPase activity" evidence=IBA
GO:0005525 "GTP binding" evidence=IEA
GO:0005829 "cytosol" evidence=IBA
GO:0006184 "GTP catabolic process" evidence=IBA
GO:0006974 "response to DNA damage stimulus" evidence=ISO
GO:0042254 "ribosome biogenesis" evidence=IBA
UNIPROTKB|A8MPZ0 GNL1 "cDNA FLJ53828, highly similar to Guanine nucleotide-binding protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0V0L0 GNL1 "Guanine nucleotide-binding protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DWZ0 GNL1 "cDNA FLJ52448, moderately similar to Guanine nucleotide-binding protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETJ1 GNL1 "Guanine nucleotide-binding protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P36915 GNL1 "Guanine nucleotide-binding protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TM59 GNL1 "Guanine nucleotide-binding protein-like 1" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
UNIPROTKB|Q7YR35 GNL1 "Guanine nucleotide-binding protein-like 1" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms
UNIPROTKB|I7GF95 GNL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1303051 Gnl1 "guanine nucleotide binding protein-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P36915GNL1_HUMANNo assigned EC number0.56840.72300.2322yesN/A
Q5TM59GNL1_MACMUNo assigned EC number0.56840.72300.2322yesN/A
Q5RA07GNL1_PONABNo assigned EC number0.56840.72300.2322yesN/A
Q6MG06GNL1_RATNo assigned EC number0.56160.72300.2322yesN/A
P36916GNL1_MOUSENo assigned EC number0.56840.72300.2322yesN/A
Q7YR35GNL1_PANTRNo assigned EC number0.56840.72300.2322yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 1e-21
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 3e-21
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 5e-14
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 3e-04
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 3e-04
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 3e-04
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 0.003
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 0.003
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 0.003
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
 Score = 85.4 bits (212), Expect = 1e-21
 Identities = 27/35 (77%), Positives = 28/35 (80%)

Query: 42  QVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFP 76
           + VSVS TPG TKHFQTIFL   I LCDCPGLVFP
Sbjct: 106 KKVSVSSTPGKTKHFQTIFLEPGITLCDCPGLVFP 140


Human HSR1 is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N-terminus. Length = 140

>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 195
KOG1424|consensus562 100.0
KOG2484|consensus435 100.0
KOG2423|consensus572 100.0
PRK09563287 rbgA GTPase YlqF; Reviewed 100.0
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 100.0
COG1161322 Predicted GTPases [General function prediction onl 100.0
KOG2485|consensus335 99.87
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.63
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.59
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.58
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.38
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.32
PRK13796365 GTPase YqeH; Provisional 99.29
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.22
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.19
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.15
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.15
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.13
COG0218200 Predicted GTPase [General function prediction only 99.13
PRK12289352 GTPase RsgA; Reviewed 99.11
COG1159 298 Era GTPase [General function prediction only] 99.1
KOG1424|consensus562 99.07
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.07
PRK12288347 GTPase RsgA; Reviewed 98.99
COG1160 444 Predicted GTPases [General function prediction onl 98.97
KOG1423|consensus 379 98.97
PRK12298390 obgE GTPase CgtA; Reviewed 98.95
TIGR00436270 era GTP-binding protein Era. Era is an essential G 98.86
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.84
COG1084346 Predicted GTPase [General function prediction only 98.81
KOG2423|consensus572 98.81
PRK00098298 GTPase RsgA; Reviewed 98.77
PRK09601 364 GTP-binding protein YchF; Reviewed 98.75
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.75
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.73
COG0486454 ThdF Predicted GTPase [General function prediction 98.73
PRK12299335 obgE GTPase CgtA; Reviewed 98.72
PTZ00258 390 GTP-binding protein; Provisional 98.72
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.71
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.7
PRK12297424 obgE GTPase CgtA; Reviewed 98.68
PRK12296 500 obgE GTPase CgtA; Reviewed 98.6
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.58
PRK00089 292 era GTPase Era; Reviewed 98.58
PRK04213201 GTP-binding protein; Provisional 98.57
PRK15494 339 era GTPase Era; Provisional 98.55
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.54
COG1160444 Predicted GTPases [General function prediction onl 98.52
KOG1191|consensus531 98.5
PRK03003 472 GTP-binding protein Der; Reviewed 98.49
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.48
PRK00093 435 GTP-binding protein Der; Reviewed 98.48
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.44
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 98.43
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.4
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.39
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 98.38
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 98.38
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.38
PRK11058426 GTPase HflX; Provisional 98.38
PRK00093435 GTP-binding protein Der; Reviewed 98.37
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.36
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.36
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.34
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.32
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.3
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.3
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.3
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.27
PRK03003472 GTP-binding protein Der; Reviewed 98.27
PRK09602 396 translation-associated GTPase; Reviewed 98.25
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.22
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.2
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.18
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 98.17
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.12
cd01896233 DRG The developmentally regulated GTP-binding prot 98.12
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.07
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.03
PRK01889356 GTPase RsgA; Reviewed 98.03
PLN03118211 Rab family protein; Provisional 98.03
KOG1490|consensus 620 97.95
cd04171164 SelB SelB subfamily. SelB is an elongation factor 97.95
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 97.93
cd00154159 Rab Rab family. Rab GTPases form the largest famil 97.93
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 97.92
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 97.86
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 97.86
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 97.84
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 97.8
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 97.8
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 97.79
COG1163 365 DRG Predicted GTPase [General function prediction 97.78
KOG1489|consensus366 97.78
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 97.78
cd01878204 HflX HflX subfamily. A distinct conserved domain w 97.76
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 97.75
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 97.74
KOG2484|consensus435 97.74
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 97.74
COG0536369 Obg Predicted GTPase [General function prediction 97.72
PRK15467158 ethanolamine utilization protein EutP; Provisional 97.7
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 97.69
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 97.68
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 97.68
cd00881189 GTP_translation_factor GTP translation factor fami 97.65
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 97.62
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 97.62
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 97.61
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 97.6
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 97.57
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 97.55
COG3596296 Predicted GTPase [General function prediction only 97.53
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 97.53
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 97.52
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.5
smart00178184 SAR Sar1p-like members of the Ras-family of small 97.5
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 97.49
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 97.48
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 97.48
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 97.44
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 97.44
KOG2486|consensus320 97.43
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 97.43
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 97.43
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 97.43
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 97.42
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 97.42
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 97.39
COG0012 372 Predicted GTPase, probable translation factor [Tra 97.37
cd00876160 Ras Ras family. The Ras family of the Ras superfam 97.35
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 97.35
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 97.35
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 97.33
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 97.3
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 97.29
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 97.29
COG1162301 Predicted GTPases [General function prediction onl 97.29
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 97.28
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 97.27
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 97.25
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 97.25
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 97.24
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 97.24
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 97.22
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 97.21
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 97.21
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 97.2
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 97.19
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 97.16
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 97.15
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 97.13
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.12
cd04123162 Rab21 Rab21 subfamily. The localization and functi 97.11
COG1161322 Predicted GTPases [General function prediction onl 97.11
PLN03110216 Rab GTPase; Provisional 97.09
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 97.09
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 97.08
PRK12317 425 elongation factor 1-alpha; Reviewed 97.08
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 97.07
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 97.07
CHL00071 409 tufA elongation factor Tu 97.05
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 97.03
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 97.02
PTZ00133182 ADP-ribosylation factor; Provisional 97.0
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 96.98
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 96.97
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 96.96
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 96.94
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 96.94
KOG1491|consensus 391 96.94
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 96.93
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 96.9
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 96.86
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 96.85
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 96.83
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 96.83
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 96.83
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 96.82
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 96.76
PLN00223181 ADP-ribosylation factor; Provisional 96.75
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 96.75
PTZ00369189 Ras-like protein; Provisional 96.74
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 96.72
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 96.72
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 96.69
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 96.68
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 96.68
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 96.67
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 96.66
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 96.66
PLN03108210 Rab family protein; Provisional 96.66
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 96.63
PRK05306 787 infB translation initiation factor IF-2; Validated 96.62
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 96.62
PLN03071219 GTP-binding nuclear protein Ran; Provisional 96.62
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 96.54
PRK12735 396 elongation factor Tu; Reviewed 96.47
CHL00189 742 infB translation initiation factor 2; Provisional 96.43
COG1100219 GTPase SAR1 and related small G proteins [General 96.43
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 96.39
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 96.37
COG0218200 Predicted GTPase [General function prediction only 96.35
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 96.26
KOG1486|consensus 364 96.25
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 96.25
cd04105203 SR_beta Signal recognition particle receptor, beta 96.23
PRK12739 691 elongation factor G; Reviewed 96.22
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 96.1
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 96.06
PRK09563287 rbgA GTPase YlqF; Reviewed 96.04
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 96.01
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 95.99
PRK00049 396 elongation factor Tu; Reviewed 95.98
PLN03127 447 Elongation factor Tu; Provisional 95.98
PRK00007 693 elongation factor G; Reviewed 95.94
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 95.88
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 95.87
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 95.84
PRK04004 586 translation initiation factor IF-2; Validated 95.83
TIGR00485 394 EF-Tu translation elongation factor TU. This align 95.8
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 95.68
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 95.61
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 95.53
KOG1547|consensus336 95.49
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 95.44
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 95.43
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 95.41
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 95.35
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 95.27
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 95.26
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 95.25
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 95.23
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 95.14
PRK12736 394 elongation factor Tu; Reviewed 95.13
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 95.09
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 95.08
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 95.05
KOG1487|consensus 358 95.0
COG2262411 HflX GTPases [General function prediction only] 94.83
PLN03126 478 Elongation factor Tu; Provisional 94.75
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 94.69
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 94.51
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 94.42
COG5019 373 CDC3 Septin family protein [Cell division and chro 94.23
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 94.14
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 94.01
PF00025175 Arf: ADP-ribosylation factor family The prints ent 93.95
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 93.86
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 93.52
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 93.22
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 93.02
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 92.97
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 92.85
PLN00023 334 GTP-binding protein; Provisional 92.68
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 92.44
TIGR00503 527 prfC peptide chain release factor 3. This translat 92.4
PRK10218 607 GTP-binding protein; Provisional 92.3
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 92.11
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 92.08
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 91.76
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 91.65
KOG2655|consensus 366 91.58
PRK00741 526 prfC peptide chain release factor 3; Provisional 91.51
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 91.49
PTZ00416 836 elongation factor 2; Provisional 91.19
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 90.99
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 90.92
PRK13351 687 elongation factor G; Reviewed 90.77
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 90.23
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 89.91
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 89.88
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 89.83
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 89.74
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 89.66
PRK05433 600 GTP-binding protein LepA; Provisional 89.6
PRK08118167 topology modulation protein; Reviewed 89.11
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 88.52
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 88.37
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 88.35
KOG0395|consensus196 88.32
PRK00625173 shikimate kinase; Provisional 88.18
PRK07261171 topology modulation protein; Provisional 87.89
PLN00116 843 translation elongation factor EF-2 subunit; Provis 87.89
PRK09866 741 hypothetical protein; Provisional 87.31
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 86.93
PRK03839180 putative kinase; Provisional 86.89
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 86.74
PRK13796365 GTPase YqeH; Provisional 86.18
KOG0410|consensus410 86.15
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 86.09
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 85.95
PRK13949169 shikimate kinase; Provisional 85.65
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 85.2
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 84.88
PRK12740 668 elongation factor G; Reviewed 84.82
PRK13947171 shikimate kinase; Provisional 84.09
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 82.86
KOG1249|consensus572 82.58
KOG3347|consensus176 82.43
PRK14530215 adenylate kinase; Provisional 82.37
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 82.34
PRK07560 731 elongation factor EF-2; Reviewed 81.27
PTZ00141 446 elongation factor 1- alpha; Provisional 80.93
COG0703172 AroK Shikimate kinase [Amino acid transport and me 80.78
PRK06217183 hypothetical protein; Validated 80.45
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 80.17
>KOG1424|consensus Back     alignment and domain information
Probab=100.00  E-value=1e-44  Score=326.10  Aligned_cols=163  Identities=40%  Similarity=0.632  Sum_probs=149.9

Q ss_pred             ceEeecCCCCccCC--CCCCCCcccccCCCCCCccceeEEEecCCeEEecCCCCCCCCCCC-hhhhhhhCCCCCccccCH
Q psy3587          22 NIRLCDCPGLVFPS--KVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVP-KPLQVLMGSFPIAQLREP   98 (195)
Q Consensus        22 ~v~vvG~PNVGKSs--N~L~~kk~v~vg~~PGvTk~~Q~i~l~~~i~LlDtPGIv~p~~~~-~~~l~l~g~~~~~~i~d~   98 (195)
                      .||+||||||||||  |+|+|+|.|+|+++||+|||+|+|.|++.+.||||||++||++.. ...|+|.|++|+|+++|+
T Consensus       316 tVG~VGYPNVGKSSTINaLvG~KkVsVS~TPGkTKHFQTi~ls~~v~LCDCPGLVfPSf~~~r~emvl~GiLPIDQmrd~  395 (562)
T KOG1424|consen  316 TVGFVGYPNVGKSSTINALVGRKKVSVSSTPGKTKHFQTIFLSPSVCLCDCPGLVFPSFSPTRAEMVLNGILPIDQLRDH  395 (562)
T ss_pred             EEEeecCCCCchhHHHHHHhcCceeeeecCCCCcceeEEEEcCCCceecCCCCccccCCCchHHHHHHhcCccHHHhhcc
Confidence            59999999999999  999999999999999999999999999999999999999999987 567999999999999999


Q ss_pred             HHHHHHHHHHcCHHHHhhcCC------CCCCCcCCHHHHHHHHHHHcCcccccCCcccHHHHHHHHHHHHHcCCcceEeC
Q psy3587          99 YSTVQYLAERMDLIKLLHIKH------PDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLM  172 (195)
Q Consensus        99 ~~~~~~l~~~~~~~~l~~~~~------~~~~~~~~~~e~L~~iA~k~g~l~~kgG~~D~~rAa~~~L~d~~~Gkl~~~~~  172 (195)
                      ..++.+|++++|++.|..+|.      +++..+++..++|.++|.+|||++ .+|.+|..|||+.||+||.+|||.|+.+
T Consensus       396 ~~~~~llaerIP~~~Le~~Y~~k~~e~~~~~~pp~A~ell~a~a~~RGfmt-s~~~~D~~RAAr~ILKDyv~GKL~~~~~  474 (562)
T KOG1424|consen  396 YGAVGLLAERIPRHVLERLYGHKPREDPEDSRPPSAAELLNAYAYKRGFMT-SKGLPDEYRAARYILKDYVSGKLLYCFP  474 (562)
T ss_pred             cchHHHHHHhcCHHHHHHHhCCCcccccCCCCCchHHHHHHHHHHhcchhh-hccCCcchHHHHHHHHHHhCCeeeeeeC
Confidence            999999999999888877773      333456789999999999999995 5566699999999999999999999999


Q ss_pred             CCCCCCccccccc
Q psy3587         173 PPQYLSKQGVSKH  185 (195)
Q Consensus       173 Pp~~~~~~~~~~~  185 (195)
                      ||++++.+++|..
T Consensus       475 PPg~~~~~~~~~~  487 (562)
T KOG1424|consen  475 PPGYEPQKFTWEE  487 (562)
T ss_pred             CCCCCccccchhh
Confidence            9999988877663



>KOG2484|consensus Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>KOG1249|consensus Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 7e-11
3cnl_A262 YLQF, putative uncharacterized protein; circular p 7e-10
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 9e-04
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
 Score = 58.9 bits (143), Expect = 7e-11
 Identities = 23/141 (16%), Positives = 46/141 (32%), Gaps = 22/141 (15%)

Query: 43  VVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQ----VLMGSFPIAQLREP 98
           +      PG T   Q + +   + L D PG+++P K    L      + G+  I      
Sbjct: 145 IAKTGDRPGITTSQQWVKVGKELELLDTPGILWP-KFEDELVGLRLAVTGA--IKDSIIN 201

Query: 99  YSTV-QYLAERM------DLIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDS 151
              V  +    +       L +   +    +D      ++ D   +KR  +    G  + 
Sbjct: 202 LQDVAVFGLRFLEEHYPERLKERYGLDEIPED----IAELFDAIGEKRGCLM-SGGLINY 256

Query: 152 YRAANELL---RMATEGRICL 169
            +    ++   R    GR+  
Sbjct: 257 DKTTEVIIRDIRTEKFGRLSF 277


>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 195
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 5e-10
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]
 Score = 55.2 bits (132), Expect = 5e-10
 Identities = 22/138 (15%), Positives = 50/138 (36%), Gaps = 16/138 (11%)

Query: 43  VVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKPLQVLMGSFPIAQLREPYSTV 102
           +      PG T   Q + +   + L D PG+++P    +   V +       +++    +
Sbjct: 137 IAKTGDRPGITTSQQWVKVGKELELLDTPGILWPKFEDE--LVGLRLAVTGAIKDSIINL 194

Query: 103 QYLAERMDLIKLLHIKHPD--------DDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRA 154
           Q +A     ++ L   +P+        D+      ++ D   +KR  +    G  +  + 
Sbjct: 195 QDVAVF--GLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLM-SGGLINYDKT 251

Query: 155 ANELL---RMATEGRICL 169
              ++   R    GR+  
Sbjct: 252 TEVIIRDIRTEKFGRLSF 269


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 100.0
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.13
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 98.93
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.89
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.76
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.69
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 98.64
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.63
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.61
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.6
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.52
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 98.46
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.46
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.42
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.42
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.41
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.33
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.11
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.0
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.88
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.85
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 97.84
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.66
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.61
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 97.58
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.57
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.52
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 97.51
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.36
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.31
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.3
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.29
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 97.27
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 97.27
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.27
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.24
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.24
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 97.17
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 97.13
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 97.11
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.08
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.07
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 96.93
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.93
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 96.92
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 96.85
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.84
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 96.83
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.77
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.68
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 96.68
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 96.67
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 96.61
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.53
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 96.52
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 96.51
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 96.4
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.34
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 96.33
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.31
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.29
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 96.22
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 96.15
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 96.14
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 96.12
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 96.05
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.02
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.0
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 95.97
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.87
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.79
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.77
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.7
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 95.38
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.22
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.1
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 94.53
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.26
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 94.06
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 93.83
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 93.6
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.46
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.95
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.08
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 91.79
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.64
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.18
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.15
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 90.02
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 89.49
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.51
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 87.83
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 87.57
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.18
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 87.05
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 86.94
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 86.12
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 85.24
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 84.97
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 84.94
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 84.73
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 84.3
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 83.94
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 83.44
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 83.3
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 82.92
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 82.15
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 82.1
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 80.84
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 80.77
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 80.28
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]
Probab=100.00  E-value=4.7e-39  Score=270.92  Aligned_cols=148  Identities=12%  Similarity=0.131  Sum_probs=116.8

Q ss_pred             ceEeecCCCCccCC--CCCCCCcccccCCCCCCccceeEEEecCCeEEecCCCCCCCCCCChh---hhhhhCCCCCcccc
Q psy3587          22 NIRLCDCPGLVFPS--KVPKPLQVVSVSRTPGHTKHFQTIFLTDNIRLCDCPGLVFPSKVPKP---LQVLMGSFPIAQLR   96 (195)
Q Consensus        22 ~v~vvG~PNVGKSs--N~L~~kk~v~vg~~PGvTk~~Q~i~l~~~i~LlDtPGIv~p~~~~~~---~l~l~g~~~~~~i~   96 (195)
                      +++|||+|||||||  |+|.++++++||+.||+||++||++++++++|+|||||++|++.+++   .++++|+++.. +.
T Consensus       114 ~v~vvG~PNvGKSsliN~L~~~~~~~~~~~pG~Tr~~~~i~~~~~~~l~DTPGi~~p~~~~~~~~~~la~~~~i~~~-~~  192 (273)
T d1puja_         114 RALIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTSQQWVKVGKELELLDTPGILWPKFEDELVGLRLAVTGAIKDS-II  192 (273)
T ss_dssp             EEEEEESTTSSHHHHHHHHHTSCCC------------CCEEETTTEEEEECCCCCCSCCCCHHHHHHHHHHTSSCTT-SS
T ss_pred             EEEEEecCccchhhhhhhhhccceEEECCcccccccceEEECCCCeEEecCCCccccCCccHHHHhhhhhcCCcchh-hc
Confidence            69999999999999  99999999999999999999999999999999999999999998864   47899998855 55


Q ss_pred             CHHHHHHHHHHHcC---HHHHhhcCCCCCCCcCCHHHHHHHHHHHcCcccccCCcccHHHHHHHHHHHHHcCCcceEeC
Q psy3587          97 EPYSTVQYLAERMD---LIKLLHIKHPDDDEYWCAMDICDGWAQKRSYMTAKTGRYDSYRAANELLRMATEGRICLCLM  172 (195)
Q Consensus        97 d~~~~~~~l~~~~~---~~~l~~~~~~~~~~~~~~~e~L~~iA~k~g~l~~kgG~~D~~rAa~~~L~d~~~Gkl~~~~~  172 (195)
                      +....+.++++.+.   .+.+...|+.+.. ..+.++||+++|+++|++ .|||+||+++||+.||+|||+|+|+++++
T Consensus       193 ~~~~~~~~ll~~l~~~~~~~l~~~~~~~~~-~~d~~~~l~~ia~~~g~~-~kgg~~D~~~aa~~~l~d~r~G~lg~~~l  269 (273)
T d1puja_         193 NLQDVAVFGLRFLEEHYPERLKERYGLDEI-PEDIAELFDAIGEKRGCL-MSGGLINYDKTTEVIIRDIRTEKFGRLSF  269 (273)
T ss_dssp             CHHHHHHHHHHHHHHHCHHHHHHHTTCSSC-CSSHHHHHHHHHHHHTCB-CSTTCBCHHHHHHHHHHHHHTTTTCSCCS
T ss_pred             chhhHHHHHHHHHHHhChHhhhHhcCCCCC-CCCHHHHHHHHHHHhCCc-ccCCccCHHHHHHHHHHHHHcCCCceeec
Confidence            56666777766554   3456666665532 358999999999999999 69999999999999999999999999975



>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure