Diaphorina citri psyllid: psy3603


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MWEKKLAGSHPEKNHGMRAERKEINRKKEAMDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPVNAPQSANGNSNPGNMNNSGNNKGNMRPNPIDRDVNRYSNNPDKGSSSSTQNTWVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTAEKHSGEIRPGTVRCDC
cccccccccccccccccEEEEEcccccccccEEEEcccccccccEEEEEEEEEccccEEECcccEEEEEEEcccccEEEEEEccccccccccccEEEEcccEEEEEEcEEEEEccccccEEEEccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEECcccccEEEEEECccccEEEEEEEEEEEEEEEEEEECccccEEEEEEEEccccEEEccCEECcc
******************************MDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSI**********************************************************TWVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTAEKHSGEIRPGTVRCD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWEKKLAGSHPEKNHGMRAERKEINRKKEAMDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPVNAPQSANGNSNPGNMNNSGNNKGNMRPNPIDRDVNRYSNNPDKGSSSSTQNTWVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTAEKHSGEIRPGTVRCDC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SOSS complex subunit B2 Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.confidentA5D7P8
SOSS complex subunit B homolog confidentQ9VM17

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0070876 [CC]SOSS complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O7I, chain A
Confidence level:very confident
Coverage over the Query: 31-148
View the alignment between query and template
View the model in PyMOL