Psyllid ID: psy3603

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MWEKKLAGSHPEKNHGMRAERKEINRKKEAMDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPVNAPQSANGNSNPGNMNNSGNNKGNMRPNPIDRDVNRYSNNPDKGSSSSTQNTWVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTAEKHSGEIRPGTVRCDC
cccccccccccccccccEEEEEcccccccccEEEEcccccccccEEEEEEEEEccccEEEEcccEEEEEEEcccccEEEEEEccccccccccccEEEEcccEEEEEEcEEEEEccccccEEEEccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEccccEEEEEEEEEEEEEEEEEEEEccccEEEEEEEEccccEEEccEEEEcc
cHHHHHccccccccccEEEEHHHHccccccccEEEEEcccccccEEEEEEEEEccccEEcccccEEEEEEEEccccEEEEEEEcccccccccccEEEEEccEEEEEccEEEEEEccccEEEEEccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEEcccccEEEEEEEEEEEEEEcEEcccccccEEEEEEEEcccEEEEcccEEccc
mwekklagshpeknhgmRAERKEINRKKEAMDVYIKDLHVGIKNVNVTCIvldisprvtlkenrevrtlkvadsTACInlslwdepgallhpgdivRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNenldmsipipnlpvnapqsangnsnpgnmnnsgnnkgnmrpnpidrdvnrysnnpdkgsssstqntwvtwdqllpvkfqffssssrtlkfsnfeCGVYLDMclrrrtshshWFRLTaekhsgeirpgtvrcdc
mwekklagshpeknhgmraeRKEINRKKEAMDVYIKDLhvgiknvnvtcivldisprvtlkenrevrtlkvadsTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPVNAPQSANGNSNPGNMNNSGNNKGNMRPNPIDRDVNRYSNNpdkgsssstqntwVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFrltaekhsgeirpgtvrcdc
MWEKKLAGSHPEKNHGMRAERKEINRKKEAMDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPVNAPQSAngnsnpgnmnnsgnnkgnmrpnPIDRDVNRYSNNPDKGSSSSTQNTWVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTAEKHSGEIRPGTVRCDC
******************************MDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPI********************************************************TWVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTA****************
*********************************YIKDLHVGIKNVNVTCIVLDIS**********VRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDM*****************************************************************DQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTAEKHSGEIRPGTVRCD*
******************AERKEINRKKEAMDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPVNAPQSANGNSNPGNMNNSGNNKGNMRPNPIDRDVNRYSN***********NTWVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTAEKHSGEIRPGTVRCDC
*WE*KLAGSHPEKNHGMRAERKEINRKKEAMDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSI********************************************************QNTWVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTAEKHSGEIRPGTVRCDC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWEKKLAGSHPEKNHGMRAERKEINRKKEAMDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPVNAPQSANGNSNPGNMNNSGNNKGNMRPNPIDRDVNRYSNNPDKGSSSSTQNTWVTWDQLLPVKFQFFSSSSRTLKFSNFECGVYLDMCLRRRTSHSHWFRLTAEKHSGEIRPGTVRCDC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query264 2.2.26 [Sep-21-2011]
Q9VM17204 SOSS complex subunit B ho yes N/A 0.397 0.514 0.647 6e-35
Q6NRF9203 SOSS complex subunit B1-B N/A N/A 0.613 0.798 0.404 4e-29
Q96AH0204 SOSS complex subunit B2 O yes N/A 0.416 0.539 0.5 4e-29
A5D7P8206 SOSS complex subunit B2 O yes N/A 0.416 0.533 0.509 5e-29
Q5PRC7211 SOSS complex subunit B2 O yes N/A 0.553 0.691 0.436 3e-28
Q8BGW5198 SOSS complex subunit B2 O yes N/A 0.416 0.555 0.5 3e-28
Q5FVP2198 SOSS complex subunit B2 O yes N/A 0.416 0.555 0.5 5e-28
Q66K94203 SOSS complex subunit B1 O yes N/A 0.534 0.694 0.418 5e-28
Q3SWT1211 SOSS complex subunit B1 O no N/A 0.450 0.563 0.471 6e-28
Q9BQ15211 SOSS complex subunit B1 O no N/A 0.477 0.597 0.476 7e-28
>sp|Q9VM17|SOSSB_DROME SOSS complex subunit B homolog OS=Drosophila melanogaster GN=CG5181 PE=2 SV=1 Back     alignment and function desciption
 Score =  147 bits (372), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 68/105 (64%), Positives = 83/105 (79%)

Query: 35  IKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGD 94
           IKD+  G+KN+NV  IVL++      KENREVR  KV D TACIN+S+WDEPG L+ PGD
Sbjct: 9   IKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEPGKLIAPGD 68

Query: 95  IVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIP 139
           IVRLTK YA IWR+CLTLYS K+G + KIGE+CMVFNE+++MS P
Sbjct: 69  IVRLTKGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEP 113

Drosophila melanogaster (taxid: 7227)
>sp|Q6NRF9|SOB1B_XENLA SOSS complex subunit B1-B OS=Xenopus laevis GN=nabp2-b PE=2 SV=1 Back     alignment and function description
>sp|Q96AH0|SOSB2_HUMAN SOSS complex subunit B2 OS=Homo sapiens GN=NABP1 PE=1 SV=1 Back     alignment and function description
>sp|A5D7P8|SOSB2_BOVIN SOSS complex subunit B2 OS=Bos taurus GN=NABP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5PRC7|SOSB2_DANRE SOSS complex subunit B2 OS=Danio rerio GN=nabp1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BGW5|SOSB2_MOUSE SOSS complex subunit B2 OS=Mus musculus GN=Nabp1 PE=2 SV=1 Back     alignment and function description
>sp|Q5FVP2|SOSB2_RAT SOSS complex subunit B2 OS=Rattus norvegicus GN=Nabp1 PE=2 SV=1 Back     alignment and function description
>sp|Q66K94|SOSB1_XENTR SOSS complex subunit B1 OS=Xenopus tropicalis GN=nabp2 PE=2 SV=1 Back     alignment and function description
>sp|Q3SWT1|SOSB1_RAT SOSS complex subunit B1 OS=Rattus norvegicus GN=Nabp2 PE=2 SV=1 Back     alignment and function description
>sp|Q9BQ15|SOSB1_HUMAN SOSS complex subunit B1 OS=Homo sapiens GN=NABP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
332025703243 SOSS complex subunit B-like protein [Acr 0.621 0.674 0.549 6e-40
322788271156 hypothetical protein SINV_07812 [Solenop 0.515 0.871 0.627 2e-39
307213538 509 Solute carrier family 35 member C2 [Harp 0.507 0.263 0.642 6e-39
307166836240 Oligonucleotide/oligosaccharide-binding 0.515 0.566 0.622 8e-39
94468674215 hypothetical conserved protein [Aedes ae 0.526 0.646 0.566 5e-38
340716300 509 PREDICTED: solute carrier family 35 memb 0.507 0.263 0.621 1e-37
350406478 509 PREDICTED: solute carrier family 35 memb 0.507 0.263 0.621 1e-37
157106273229 hypothetical protein AaeL_AAEL014645 [Ae 0.526 0.606 0.566 2e-37
170040552243 conserved hypothetical protein [Culex qu 0.564 0.613 0.493 2e-36
345490630147 PREDICTED: SOSS complex subunit B homolo 0.420 0.755 0.684 5e-36
>gi|332025703|gb|EGI65861.1| SOSS complex subunit B-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  170 bits (430), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 94/171 (54%), Positives = 114/171 (66%), Gaps = 7/171 (4%)

Query: 33  VYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHP 92
           V IKD+  G KN+NV  IVL++S     KENREVRT KVADSTAC+N+S+WDEPG LL P
Sbjct: 4   VQIKDIRAGQKNINVVFIVLEVSHPTITKENREVRTFKVADSTACMNVSIWDEPGQLLMP 63

Query: 93  GDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLP---VNAPQ 149
           GDIVRLTK YA +WR CLTLYS K+G I+KIGEFCMV NE ++MS P P L    VN  Q
Sbjct: 64  GDIVRLTKGYASVWRQCLTLYSGKNGDIQKIGEFCMVINEQVNMSEPNPMLVQQLVNRDQ 123

Query: 150 SANGNSNPGNMNNSGNNKGN---MRPNPIDRDVNRYSNNPDKGSSSSTQNT 197
           S +G  +  N+NNS  N GN   +   P  + +   SN    GS S+  +T
Sbjct: 124 SGSGPPS-SNVNNSITNNGNANSISGQPGRQPLASQSNTTTAGSGSAASST 173

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322788271|gb|EFZ14020.1| hypothetical protein SINV_07812 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307213538|gb|EFN88947.1| Solute carrier family 35 member C2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307166836|gb|EFN60766.1| Oligonucleotide/oligosaccharide-binding fold-containing protein 2B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|94468674|gb|ABF18186.1| hypothetical conserved protein [Aedes aegypti] Back     alignment and taxonomy information
>gi|340716300|ref|XP_003396637.1| PREDICTED: solute carrier family 35 member C2-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350406478|ref|XP_003487785.1| PREDICTED: solute carrier family 35 member C2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|157106273|ref|XP_001649250.1| hypothetical protein AaeL_AAEL014645 [Aedes aegypti] gi|108868878|gb|EAT33103.1| AAEL014645-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170040552|ref|XP_001848059.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167864169|gb|EDS27552.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|345490630|ref|XP_001601525.2| PREDICTED: SOSS complex subunit B homolog [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
FB|FBgn0031909204 CG5181 [Drosophila melanogaste 0.397 0.514 0.647 5.8e-34
UNIPROTKB|Q96AH0204 NABP1 "SOSS complex subunit B2 0.443 0.573 0.5 6.4e-28
UNIPROTKB|F1NRZ8210 OBFC2A "Uncharacterized protei 0.401 0.504 0.555 1e-27
UNIPROTKB|F1P1M0194 OBFC2A "Uncharacterized protei 0.401 0.546 0.555 1e-27
UNIPROTKB|A5D7P8206 NABP1 "SOSS complex subunit B2 0.412 0.529 0.531 1.3e-27
UNIPROTKB|F1SN32204 NABP1 "Uncharacterized protein 0.412 0.534 0.531 1.3e-27
ZFIN|ZDB-GENE-041212-71217 nabp1a "nucleic acid binding p 0.465 0.566 0.5 2.8e-27
UNIPROTKB|C9JMP5152 NABP2 "SOSS complex subunit B1 0.450 0.782 0.491 5.7e-27
UNIPROTKB|C9JT95144 NABP2 "SOSS complex subunit B1 0.450 0.826 0.491 5.7e-27
UNIPROTKB|Q9BQ15211 NABP2 "SOSS complex subunit B1 0.450 0.563 0.491 5.7e-27
FB|FBgn0031909 CG5181 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 369 (135.0 bits), Expect = 5.8e-34, P = 5.8e-34
 Identities = 68/105 (64%), Positives = 83/105 (79%)

Query:    35 IKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGD 94
             IKD+  G+KN+NV  IVL++      KENREVR  KV D TACIN+S+WDEPG L+ PGD
Sbjct:     9 IKDIKPGLKNINVIFIVLEVGVATVTKENREVRNFKVGDPTACINVSIWDEPGKLIAPGD 68

Query:    95 IVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIP 139
             IVRLTK YA IWR+CLTLYS K+G + KIGE+CMVFNE+++MS P
Sbjct:    69 IVRLTKGYASIWRHCLTLYSGKNGEVFKIGEYCMVFNESVNMSEP 113
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|Q96AH0 NABP1 "SOSS complex subunit B2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRZ8 OBFC2A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1M0 OBFC2A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7P8 NABP1 "SOSS complex subunit B2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SN32 NABP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041212-71 nabp1a "nucleic acid binding protein 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|C9JMP5 NABP2 "SOSS complex subunit B1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JT95 NABP2 "SOSS complex subunit B1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQ15 NABP2 "SOSS complex subunit B1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A5D7P8SOSB2_BOVINNo assigned EC number0.50900.41660.5339yesN/A
Q9VM17SOSSB_DROMENo assigned EC number0.64760.39770.5147yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
cd0449182 cd04491, SoSSB_OBF, SoSSB_OBF: A subfamily of OB f 3e-17
PRK06461129 PRK06461, PRK06461, single-stranded DNA-binding pr 1e-09
PRK12366 637 PRK12366, PRK12366, replication factor A; Reviewed 5e-09
PRK07218 423 PRK07218, PRK07218, replication factor A; Provisio 2e-06
PRK07218423 PRK07218, PRK07218, replication factor A; Provisio 2e-04
PRK07211485 PRK07211, PRK07211, replication factor A; Reviewed 3e-04
PRK15491374 PRK15491, PRK15491, replication factor A; Provisio 5e-04
PRK14699484 PRK14699, PRK14699, replication factor A; Provisio 0.001
COG1599 407 COG1599, RFA1, Single-stranded DNA-binding replica 0.004
>gnl|CDD|239937 cd04491, SoSSB_OBF, SoSSB_OBF: A subfamily of OB folds similar to the OB fold of the crenarchaeote Sulfolobus solfataricus single-stranded (ss) DNA-binding protein (SSoSSB) Back     alignment and domain information 
 Score = 74.2 bits (183), Expect = 3e-17
 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 4/82 (4%)

Query: 46  NVTCIVLDISPRVTL---KENREVRTLKVADSTACINLSLWDEPGAL-LHPGDIVRLTKC 101
           +V   VL IS            +V++  V D T  I  +LWDE  A  L PGD+VR+   
Sbjct: 1   SVEGKVLSISEPREFTRDGSEGKVQSGLVGDETGTIRFTLWDEKAADDLEPGDVVRIENA 60

Query: 102 YAQIWRNCLTLYSSKSGLIEKI 123
           Y + +   L L   K+  IEK+
Sbjct: 61  YVREFNGRLELSVGKNSEIEKL 82

SSoSSB has a single OB fold, and it physically and functionally interacts with RNA polymerase. In vitro, SSoSSB can substitute for the basal transcription factor TBP, stimulating transcription from promoters under conditions in which TBP is limiting, and supporting transcription when TBP is absent. SSoSSB selectively melts the duplex DNA of promoter sequences. It also relieves transcriptional repression by the chromatin Alba. In addition, SSoSSB activates reverse gyrase activity, which involves DNA binding, DNA cleavage, strand passage and ligation. SSoSSB stimulates all these steps in the presence of the chromatin protein, Sul7d. SSoSSB antagonizes the inhibitory effect of Sul7d on reverse gyrase supercoiling activity. It also physically and functionally interacts with Mini-chromosome Maintenance (MCM), stimulating the DNA helicase activity of MCM. Length = 82
>gnl|CDD|180574 PRK06461, PRK06461, single-stranded DNA-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|237078 PRK12366, PRK12366, replication factor A; Reviewed Back     alignment and domain information
>gnl|CDD|180890 PRK07218, PRK07218, replication factor A; Provisional Back     alignment and domain information
>gnl|CDD|180890 PRK07218, PRK07218, replication factor A; Provisional Back     alignment and domain information
>gnl|CDD|180887 PRK07211, PRK07211, replication factor A; Reviewed Back     alignment and domain information
>gnl|CDD|185388 PRK15491, PRK15491, replication factor A; Provisional Back     alignment and domain information
>gnl|CDD|173162 PRK14699, PRK14699, replication factor A; Provisional Back     alignment and domain information
>gnl|CDD|224515 COG1599, RFA1, Single-stranded DNA-binding replication protein A (RPA), large (70 kD) subunit and related ssDNA-binding proteins [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 264
KOG3416|consensus134 99.97
PRK06461129 single-stranded DNA-binding protein; Reviewed 99.9
PRK07218 423 replication factor A; Provisional 99.65
PRK08402355 replication factor A; Reviewed 99.64
cd0449182 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds simil 99.61
PRK06386 358 replication factor A; Reviewed 99.61
PRK06386358 replication factor A; Reviewed 99.6
PRK12366 637 replication factor A; Reviewed 99.55
PRK15491374 replication factor A; Provisional 99.54
PRK07211485 replication factor A; Reviewed 99.54
PRK07217311 replication factor A; Reviewed 99.54
PRK14699 484 replication factor A; Provisional 99.54
PRK07218423 replication factor A; Provisional 99.53
PRK13480314 3'-5' exoribonuclease YhaM; Provisional 99.5
PRK14699484 replication factor A; Provisional 99.5
PRK15491374 replication factor A; Provisional 99.49
PRK12366637 replication factor A; Reviewed 99.35
PRK07211485 replication factor A; Reviewed 99.33
cd04475101 RPA1_DBD_B RPA1_DBD_B: A subfamily of OB folds cor 99.07
cd04474104 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds cor 99.07
cd0447895 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds cor 98.92
cd04497138 hPOT1_OB1_like hPOT1_OB1_like: A subfamily of OB f 98.87
COG1599 407 RFA1 Single-stranded DNA-binding replication prote 98.84
cd0448392 hOBFC1_like hOBFC1_like: A subfamily of OB folds s 98.78
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB fol 98.73
PF0133675 tRNA_anti-codon: OB-fold nucleic acid binding doma 98.73
TIGR00617 608 rpa1 replication factor-a protein 1 (rpa1). This f 98.57
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresp 98.47
TIGR00617608 rpa1 replication factor-a protein 1 (rpa1). This f 98.45
PF02765146 POT1: Telomeric single stranded DNA binding POT1/C 98.27
cd0352475 RPA2_OBF_family RPA2_OBF_family: A family of oligo 98.27
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB fol 98.19
cd0448875 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB f 98.15
PRK056731135 dnaE DNA polymerase III subunit alpha; Validated 97.81
PRK07373449 DNA polymerase III subunit alpha; Reviewed 97.57
cd0448482 polC_OBF polC_OBF: A subfamily of OB folds corresp 97.42
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds 97.27
cd04481106 RPA1_DBD_B_like RPA1_DBD_B_like: A subgroup of unc 97.26
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB f 97.19
PRK073741170 dnaE DNA polymerase III subunit alpha; Validated 96.86
PRK056721046 dnaE2 error-prone DNA polymerase; Validated 96.62
cd0448291 RPA2_OBF_like RPA2_OBF_like: A subgroup of unchara 96.58
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 96.53
COG4085204 Predicted RNA-binding protein, contains TRAM domai 96.52
PRK068261151 dnaE DNA polymerase III DnaE; Reviewed 96.51
COG3481287 Predicted HD-superfamily hydrolase [General functi 96.5
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 96.39
PF1374299 tRNA_anti_2: OB-fold nucleic acid binding domain 96.3
PRK069201107 dnaE DNA polymerase III DnaE; Reviewed 96.18
COG5235258 RFA2 Single-stranded DNA-binding replication prote 95.98
PRK072791034 dnaE DNA polymerase III DnaE; Reviewed 95.97
cd0448086 RPA1_DBD_A_like RPA1_DBD_A_like: A subgroup of unc 95.88
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 95.67
KOG3108|consensus265 95.59
TIGR00237 432 xseA exodeoxyribonuclease VII, large subunit. This 95.56
PRK00448 1437 polC DNA polymerase III PolC; Validated 95.48
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 95.41
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 95.09
PRK02801101 primosomal replication protein N; Provisional 95.05
PRK07459121 single-stranded DNA-binding protein; Provisional 95.02
PRK06751173 single-stranded DNA-binding protein; Provisional 94.9
PRK06863168 single-stranded DNA-binding protein; Provisional 94.69
PRK05733172 single-stranded DNA-binding protein; Provisional 94.6
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, a 94.37
cd04496100 SSB_OBF SSB_OBF: A subfamily of OB folds similar t 94.17
cd04498123 hPOT1_OB2 hPOT1_OB2: A subfamily of OB folds simil 94.1
PRK08182148 single-stranded DNA-binding protein; Provisional 94.02
PRK09010177 single-stranded DNA-binding protein; Provisional 93.99
TIGR00621164 ssb single stranded DNA-binding protein (ssb). Thi 93.84
TIGR00458 428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 93.84
KOG4757|consensus 522 93.78
TIGR01405 1213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 93.7
PRK06752112 single-stranded DNA-binding protein; Validated 93.68
PRK07274131 single-stranded DNA-binding protein; Provisional 93.66
cd04322108 LysRS_N LysRS_N: N-terminal, anticodon recognition 93.63
cd04320102 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon r 93.53
PRK05159 437 aspC aspartyl-tRNA synthetase; Provisional 93.52
PRK13732175 single-stranded DNA-binding protein; Provisional 93.5
PF10451256 Stn1: Telomere regulation protein Stn1; InterPro: 93.44
PF00436104 SSB: Single-strand binding protein family; InterPr 93.44
PRK08486182 single-stranded DNA-binding protein; Provisional 93.19
cd04317135 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticod 93.19
PRK08763164 single-stranded DNA-binding protein; Provisional 93.14
cd0410085 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, ant 93.05
PF04076103 BOF: Bacterial OB fold (BOF) protein; InterPro: IP 93.04
cd0432384 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, a 92.67
cd0432186 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, a 92.62
PRK07275162 single-stranded DNA-binding protein; Provisional 92.61
PRK06293161 single-stranded DNA-binding protein; Provisional 92.49
TIGR00499 496 lysS_bact lysyl-tRNA synthetase, eukaryotic and no 91.95
PLN02502 553 lysyl-tRNA synthetase 91.72
PRK06958182 single-stranded DNA-binding protein; Provisional 91.66
KOG3056|consensus 578 91.59
PRK00484 491 lysS lysyl-tRNA synthetase; Reviewed 91.54
PF02760170 HIN: HIN-200/IF120x domain; InterPro: IPR004021 Th 91.52
PRK12445 505 lysyl-tRNA synthetase; Reviewed 91.48
PTZ00401 550 aspartyl-tRNA synthetase; Provisional 91.25
COG1599407 RFA1 Single-stranded DNA-binding replication prote 91.01
PRK07772186 single-stranded DNA-binding protein; Provisional 90.98
PRK07135973 dnaE DNA polymerase III DnaE; Validated 90.98
cd0431882 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticod 90.91
PLN02850 530 aspartate-tRNA ligase 90.69
PRK02983 1094 lysS lysyl-tRNA synthetase; Provisional 90.62
COG1570 440 XseA Exonuclease VII, large subunit [DNA replicati 90.23
PRK05813219 single-stranded DNA-binding protein; Provisional 90.21
PRK06642152 single-stranded DNA-binding protein; Provisional 89.91
cd0448678 YhcR_OBF_like YhcR_OBF_like: A subfamily of OB-fol 89.18
cd04494251 BRCA2DBD_OB2 BRCA2DBD_OB2: A subfamily of OB folds 89.1
PTZ00385 659 lysyl-tRNA synthetase; Provisional 88.54
cd04319103 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticod 87.57
TIGR00156126 conserved hypothetical protein TIGR00156. As of th 87.31
PF1507286 DUF4539: Domain of unknown function (DUF4539) 87.2
PRK03932 450 asnC asparaginyl-tRNA synthetase; Validated 86.6
COG0017 435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Transl 86.27
PRK08402355 replication factor A; Reviewed 86.24
TIGR00457 453 asnS asparaginyl-tRNA synthetase. In a multiple se 85.96
TIGR00459 583 aspS_bact aspartyl-tRNA synthetase, bacterial type 85.53
PF0272195 DUF223: Domain of unknown function DUF223; InterPr 84.56
PRK06341166 single-stranded DNA-binding protein; Provisional 84.53
TIGR005941022 polc DNA-directed DNA polymerase III (polc). This 84.21
PTZ00417 585 lysine-tRNA ligase; Provisional 84.05
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-posit 84.03
PLN02603 565 asparaginyl-tRNA synthetase 83.65
PRK05813219 single-stranded DNA-binding protein; Provisional 83.42
PF1132584 DUF3127: Domain of unknown function (DUF3127); Int 81.24
COG1571421 Predicted DNA-binding protein containing a Zn-ribb 80.91
PLN02903 652 aminoacyl-tRNA ligase 80.2
>KOG3416|consensus Back     alignment and domain information 
Probab=99.97  E-value=2.9e-30  Score=214.83  Aligned_cols=107  Identities=53%  Similarity=0.945  Sum_probs=104.6

Q ss_pred             cccccccccccccceEEEEEEEecCCceeecCCcEEEEEEEEeCCCeEEEEEecCCCCCCCCCCEEEEeeeEEEEECCEE
Q psy3603          31 MDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLKVADSTACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCL  110 (264)
Q Consensus        31 ~~ikIkDLkpG~knVnv~fiVle~~~~r~TKdGg~V~tL~LADeTGsI~ltLWdd~ad~Ik~GDIIrI~ngyVs~frG~L  110 (264)
                      +.++|+||+|+++|++++|+|++.+..+.||+|+.|+.+.+||+||+|.+.+|||.+++|+|||||++.+||++.|+|+|
T Consensus         3 ~~i~ikdi~P~~kN~~v~fIvl~~g~~tkTkdg~~v~~~kVaD~TgsI~isvW~e~~~~~~PGDIirLt~Gy~Si~qg~L   82 (134)
T KOG3416|consen    3 IMIFIKDIKPGLKNINVTFIVLEYGRATKTKDGHEVRSCKVADETGSINISVWDEEGCLIQPGDIIRLTGGYASIFQGCL   82 (134)
T ss_pred             cchhHhhcChhhhcceEEEEEEeeceeeeccCCCEEEEEEEecccceEEEEEecCcCcccCCccEEEecccchhhhcCce
Confidence            45789999999999999999999999988999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCceEEEecCceeeecCCCCCC
Q psy3603         111 TLYSSKSGLIEKIGEFCMVFNENLDMS  137 (264)
Q Consensus       111 qL~Igr~G~IekVgEf~~~fnE~pNiS  137 (264)
                      .|++||.|+++|+|||+|+|+|.||+|
T Consensus        83 tL~~GK~Ge~~KiGef~~vf~etpn~S  109 (134)
T KOG3416|consen   83 TLYVGKGGEVQKIGEFCMVFSETPNIS  109 (134)
T ss_pred             EEEecCCceEeEeeeeEEeeecCCCcc
Confidence            999999999999999999999999999

>PRK06461 single-stranded DNA-binding protein; Reviewed Back     alignment and domain information
>PRK07218 replication factor A; Provisional Back     alignment and domain information
>PRK08402 replication factor A; Reviewed Back     alignment and domain information
>cd04491 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds similar to the OB fold of the crenarchaeote Sulfolobus solfataricus single-stranded (ss) DNA-binding protein (SSoSSB) Back     alignment and domain information
>PRK06386 replication factor A; Reviewed Back     alignment and domain information
>PRK06386 replication factor A; Reviewed Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PRK15491 replication factor A; Provisional Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information
>PRK07217 replication factor A; Reviewed Back     alignment and domain information
>PRK14699 replication factor A; Provisional Back     alignment and domain information
>PRK07218 replication factor A; Provisional Back     alignment and domain information
>PRK13480 3'-5' exoribonuclease YhaM; Provisional Back     alignment and domain information
>PRK14699 replication factor A; Provisional Back     alignment and domain information
>PRK15491 replication factor A; Provisional Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information
>cd04475 RPA1_DBD_B RPA1_DBD_B: A subfamily of OB folds corresponding to the third OB fold, the ssDNA-binding domain (DBD)-B, of human RPA1 (also called RPA70) Back     alignment and domain information
>cd04474 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds corresponding to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70) Back     alignment and domain information
>cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04497 hPOT1_OB1_like hPOT1_OB1_like: A subfamily of OB folds similar to the first OB fold (OB1) of human protection of telomeres 1 protein (hPOT1), the single OB fold of the N-terminal domain of Schizosaccharomyces pombe POT1 (SpPOT1), and the first OB fold of the N-terminal domain of the alpha subunit (OB1Nalpha) of Oxytricha nova telomere end binding protein (OnTEBP) Back     alignment and domain information
>COG1599 RFA1 Single-stranded DNA-binding replication protein A (RPA), large (70 kD) subunit and related ssDNA-binding proteins [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04483 hOBFC1_like hOBFC1_like: A subfamily of OB folds similar to that found in human OB fold containing protein 1 (hOBFC1) Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>PF01336 tRNA_anti-codon: OB-fold nucleic acid binding domain; InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands Back     alignment and domain information
>TIGR00617 rpa1 replication factor-a protein 1 (rpa1) Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>TIGR00617 rpa1 replication factor-a protein 1 (rpa1) Back     alignment and domain information
>PF02765 POT1: Telomeric single stranded DNA binding POT1/CDC13; InterPro: IPR011564 This entry represents a domain that binds single stranded telomeric DNA and adopts an OB fold [] Back     alignment and domain information
>cd03524 RPA2_OBF_family RPA2_OBF_family: A family of oligonucleotide binding (OB) folds with similarity to the OB fold of the single strand (ss) DNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>cd04488 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>cd04484 polC_OBF polC_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold nucleic acid binding domain of Bacillus subtilis type C replicative DNA polymerase III alpha subunit (polC) Back     alignment and domain information
>cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit Back     alignment and domain information
>cd04481 RPA1_DBD_B_like RPA1_DBD_B_like: A subgroup of uncharacterized, plant OB folds with similarity to the third OB fold, the ssDNA-binding domain (DBD)-B, of human RPA1 (also called RPA70) Back     alignment and domain information
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ Back     alignment and domain information
>PRK07374 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK05672 dnaE2 error-prone DNA polymerase; Validated Back     alignment and domain information
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG4085 Predicted RNA-binding protein, contains TRAM domain [General function prediction only] Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>COG3481 Predicted HD-superfamily hydrolase [General function prediction only] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PF13742 tRNA_anti_2: OB-fold nucleic acid binding domain Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>COG5235 RFA2 Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07279 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>cd04480 RPA1_DBD_A_like RPA1_DBD_A_like: A subgroup of uncharacterized plant OB folds with similarity to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70) Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3108|consensus Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>PRK02801 primosomal replication protein N; Provisional Back     alignment and domain information
>PRK07459 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06751 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06863 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK05733 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04496 SSB_OBF SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB) Back     alignment and domain information
>cd04498 hPOT1_OB2 hPOT1_OB2: A subfamily of OB folds similar to the second OB fold (OB2) of human protection of telomeres 1 protein (hPOT1) Back     alignment and domain information
>PRK08182 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK09010 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>TIGR00621 ssb single stranded DNA-binding protein (ssb) Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>KOG4757|consensus Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>PRK06752 single-stranded DNA-binding protein; Validated Back     alignment and domain information
>PRK07274 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>cd04320 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK13732 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PF10451 Stn1: Telomere regulation protein Stn1; InterPro: IPR018856 The budding yeast protein Stn1 is a DNA-binding protein which has specificity for telomeric DNA Back     alignment and domain information
>PF00436 SSB: Single-strand binding protein family; InterPro: IPR000424 The Escherichia coli single-strand binding protein [] (gene ssb), also known as the helix-destabilising protein, is a protein of 177 amino acids Back     alignment and domain information
>PRK08486 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>PRK08763 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>PF04076 BOF: Bacterial OB fold (BOF) protein; InterPro: IPR005220 Proteins in this entry have an OB-fold fold (oligonucleotide/oligosaccharide binding motif) Back     alignment and domain information
>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>cd04321 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae mitochondrial (mt) aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>PRK07275 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06293 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>PLN02502 lysyl-tRNA synthetase Back     alignment and domain information
>PRK06958 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>KOG3056|consensus Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF02760 HIN: HIN-200/IF120x domain; InterPro: IPR004021 This domain has no known function Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PTZ00401 aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG1599 RFA1 Single-stranded DNA-binding replication protein A (RPA), large (70 kD) subunit and related ssDNA-binding proteins [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07772 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07135 dnaE DNA polymerase III DnaE; Validated Back     alignment and domain information
>cd04318 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS Back     alignment and domain information
>PLN02850 aspartate-tRNA ligase Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05813 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06642 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>cd04486 YhcR_OBF_like YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR Back     alignment and domain information
>cd04494 BRCA2DBD_OB2 BRCA2DBD_OB2: A subfamily of OB folds corresponding to the second OB fold (OB2) of the 800-amino acid C-terminal ssDNA binding domain (DBD) of BRCA2 (breast cancer susceptibility gene 2) protein, called BRCA2DBD Back     alignment and domain information
>PTZ00385 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd04319 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) Back     alignment and domain information
>TIGR00156 conserved hypothetical protein TIGR00156 Back     alignment and domain information
>PF15072 DUF4539: Domain of unknown function (DUF4539) Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08402 replication factor A; Reviewed Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>PF02721 DUF223: Domain of unknown function DUF223; InterPro: IPR003871 The function of this domain has not been characterised, but may be involved in nucleic acid or nucleotide binding Back     alignment and domain information
>PRK06341 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>TIGR00594 polc DNA-directed DNA polymerase III (polc) Back     alignment and domain information
>PTZ00417 lysine-tRNA ligase; Provisional Back     alignment and domain information
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02603 asparaginyl-tRNA synthetase Back     alignment and domain information
>PRK05813 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PF11325 DUF3127: Domain of unknown function (DUF3127); InterPro: IPR021474 This bacterial family of proteins has no known function Back     alignment and domain information
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>PLN02903 aminoacyl-tRNA ligase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
1o7i_A119 Crystal Structure Of A Single Stranded Dna Binding 8e-04
>pdb|1O7I|A Chain A, Crystal Structure Of A Single Stranded Dna Binding Protein Length = 119 Back     alignment and structure 
Iteration: 1

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 9/122 (7%)
Query: 31  MDVYIKDLHVGIKNVNVTCIVLDISPRVTLKENREVRTLK---VADSTACINLSLWDEPG 87
           M+  + +L   +++VNVT  VL+ S    ++    VRT+    V D T  + L+LW +  
Sbjct: 1   MEEKVGNLKPNMESVNVTVRVLEASEARQIQTKNGVRTISEAIVGDETGRVKLTLWGKHA 60
Query: 88  ALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPVNA 147
             +  G +V++   +   ++  + L    +G   KI E      +    S  IP     A
Sbjct: 61  GSIKEGQVVKIENAWTTAFKGQVQL---NAGSKTKIAEAS---EDGFPESSQIPENTPTA 114
Query: 148 PQ 149
           PQ
Sbjct: 115 PQ 116

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
1wjj_A145 Hypothetical protein F20O9.120; DNA-binding protei 8e-27
1o7i_A119 SSB, SSO2364, single stranded DNA binding protein; 4e-25
2k75_A106 Uncharacterized protein TA0387; closed beta barrel 8e-18
2k50_A115 Replication factor A related protein; uncharacteri 2e-15
3e0e_A97 Replication protein A; structural genomics, PSI-2, 2e-15
3dm3_A105 Replication factor A; probably plays AN essential 3e-13
2kbn_A109 Conserved protein; nucleic acid binding protein, b 1e-07
>1wjj_A Hypothetical protein F20O9.120; DNA-binding protein-related, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: b.40.4.3 Length = 145 Back     alignment and structure
 Score =  100 bits (250), Expect = 8e-27
 Identities = 24/124 (19%), Positives = 47/124 (37%), Gaps = 13/124 (10%)

Query: 27  KKEAMDVYIKDLHVGIKNVNVTCIVLDISPRVTLKEN-------------REVRTLKVAD 73
           K++ + V ++ L  G     +T  V++ +  V +                  +    + D
Sbjct: 11  KRKPVFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRKTRPASSLSRPSQPSRIVECLIGD 70

Query: 74  STACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNEN 133
            T CI  +  ++   L+ PG  V L      +++  + L   K G IE  G       E+
Sbjct: 71  ETGCILFTARNDQVDLMKPGATVILRNSRIDMFKGTMRLGVDKWGRIEATGAASFTVKED 130

Query: 134 LDMS 137
            ++S
Sbjct: 131 NNLS 134
>1o7i_A SSB, SSO2364, single stranded DNA binding protein; OB fold; 1.2A {Sulfolobus solfataricus} SCOP: b.40.4.3 Length = 119 Back     alignment and structure
>2k75_A Uncharacterized protein TA0387; closed beta barrel, OB fold, structural genomics, PSI-2, protein structure initiative; NMR {Thermoplasma acidophilum} Length = 106 Back     alignment and structure
>2k50_A Replication factor A related protein; uncharacterized protein, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Length = 115 Back     alignment and structure
>3e0e_A Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A Length = 97 Back     alignment and structure
>3dm3_A Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii} Length = 105 Back     alignment and structure
>2kbn_A Conserved protein; nucleic acid binding protein, beta barrel, structural genomics, PSI-2, protein structure initiative; NMR {Methanosarcina mazei} PDB: 2ken_A Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
1wjj_A145 Hypothetical protein F20O9.120; DNA-binding protei 99.93
1o7i_A119 SSB, SSO2364, single stranded DNA binding protein; 99.91
2k75_A106 Uncharacterized protein TA0387; closed beta barrel 99.89
2kbn_A109 Conserved protein; nucleic acid binding protein, b 99.85
3e0e_A97 Replication protein A; structural genomics, PSI-2, 99.82
3dm3_A105 Replication factor A; probably plays AN essential 99.74
2k50_A115 Replication factor A related protein; uncharacteri 99.72
1ynx_A114 Replication factor-A protein 1; canonical OB fold, 99.34
1jmc_A246 Protein (replication protein A (RPA)); human ssDNA 99.15
4gop_B136 Putative uncharacterized protein; OB fold, ssDNA b 98.89
4gop_C 444 Putative uncharacterized protein; OB fold, ssDNA b 98.85
1jmc_A246 Protein (replication protein A (RPA)); human ssDNA 98.82
3kdf_D132 Replication protein A 32 kDa subunit; wheat GERM c 98.8
4gop_C444 Putative uncharacterized protein; OB fold, ssDNA b 98.71
2pi2_A270 Replication protein A 32 kDa subunit; FULL-length 98.63
1xjv_A294 Protection of telomeres 1; protein-DNA complex, si 98.58
1qzg_A187 Protection of telomeres protein 1; protrein-DNA co 98.39
1jb7_A 495 Telomere-binding protein alpha subunit; DNA-protei 98.11
3kf6_A159 Protein STN1; OB fold, chromosomal protein, DNA-bi 97.78
1xjv_A294 Protection of telomeres 1; protein-DNA complex, si 96.69
4hik_A143 Protection of telomeres protein 1; specificity, pl 96.59
3f2b_A 1041 DNA-directed DNA polymerase III alpha chain; DNA p 96.39
1txy_A104 Primosomal replication protein N; OB fold, dimer, 95.59
3rn5_A208 Interferon-inducible protein AIM2; OB fold, DNA bi 95.33
3ebe_A200 Protein MCM10 homolog; OB-fold, zinc finger, CCCH, 95.08
3fhw_A115 Primosomal replication protein N; PRIB BPR162 X-RA 95.07
3au7_A402 TIAS, putative uncharacterized protein; ATP hydrol 95.06
3m4p_A 456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 95.04
2hpi_A1220 DNA polymerase III alpha subunit; POL-beta-like nu 94.99
3koj_A108 Uncharacterized protein YCF41; single-strand bindi 94.78
3k8a_A103 Putative primosomal replication protein; beta-barr 94.66
2xgt_A 435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 94.39
3u4v_A117 Telomerase-associated protein 82; TEB1, processivi 94.34
3en2_A101 Probable primosomal replication protein N; PRIB RS 94.02
4gs3_A107 Single-stranded DNA-binding protein; primosome, ol 93.78
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 93.72
2vw9_A134 Single-stranded DNA binding protein; DNA replicati 93.57
1n9w_A 422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 93.46
2oq0_A206 Gamma-interferon-inducible protein IFI-16; OB fold 93.3
1qvc_A145 Single stranded DNA binding protein monomer; beta- 93.22
3rlo_A204 Gamma-interferon-inducible protein 16; HIN200/OB f 93.17
3afp_A168 Single-stranded DNA-binding protein; OB-fold, quat 93.05
1z9f_A153 Single-strand binding protein; TM0604, single stra 92.7
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 92.58
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 92.55
3tqy_A158 Single-stranded DNA-binding protein; DNA replicati 92.54
3vdy_A116 SSB, single-stranded DNA-binding protein SSBB; OB 92.39
1e1o_A 504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 92.33
3kf8_A220 Protein STN1; OB fold; 2.40A {Candida tropicalis m 92.28
3ulp_A124 Single-strand binding protein; OB-fold, DNA bindin 92.26
1v1q_A134 Primosomal replication protein N; primosome, DNA r 92.16
3i7f_A 548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 91.86
1wyd_A 429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 91.68
3ull_A132 DNA binding protein; DNA replication, mitochondrio 91.28
3eiv_A199 Single-stranded DNA-binding protein 2; DNA damage, 91.2
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 90.77
2fxq_A264 Single-strand binding protein; strand beta-sheet e 90.55
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 90.42
4dam_A128 Single-stranded DNA-binding protein 1; OB-fold; 1. 90.27
1eqq_A178 Single stranded DNA binding protein; beta barrel, 90.27
3lgj_A169 Single-stranded DNA-binding protein; niaid, CAT sc 89.62
4ex5_A 529 Lysine--tRNA ligase; structural genomics, niaid, n 89.6
3a74_A 493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 88.65
3k7u_C148 MP18 RNA editing complex protein; OB-fold, RNA-edi 88.58
3pgz_A193 Single-stranded DNA-binding protein; ssgcid, singl 88.41
3u58_A213 Tetrahymena TEB1 AB; tetrahymena, telomerase, TEB1 88.18
1se8_A301 Single-strand binding protein; DNA binding protein 88.13
1se8_A301 Single-strand binding protein; DNA binding protein 88.1
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dim 87.3
2fxq_A264 Single-strand binding protein; strand beta-sheet e 85.85
1nnx_A109 Protein YGIW; structural genomics, hypothetical pr 85.69
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 85.1
1jb7_A495 Telomere-binding protein alpha subunit; DNA-protei 83.74
>1wjj_A Hypothetical protein F20O9.120; DNA-binding protein-related, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: b.40.4.3 Back     alignment and structure
Probab=99.93  E-value=3.1e-26  Score=192.64  Aligned_cols=118  Identities=19%  Similarity=0.296  Sum_probs=107.8

Q ss_pred             CcccccccccccccccceEEEEEEEecCCce---ee-c-CC--------cEEEEEEEEeCCCeEEEEEecCCCCCCCCCC
Q psy3603          28 KEAMDVYIKDLHVGIKNVNVTCIVLDISPRV---TL-K-EN--------REVRTLKVADSTACINLSLWDEPGALLHPGD   94 (264)
Q Consensus        28 ~~~~~ikIkDLkpG~knVnv~fiVle~~~~r---~T-K-dG--------g~V~tL~LADeTGsI~ltLWdd~ad~Ik~GD   94 (264)
                      ....+++|+||+|++++++++++|+++..++   ++ | +|        +++++++|+|+||+|.+++|+++++.|++||
T Consensus        12 ~kp~~~kI~dL~pg~~~v~l~~kVl~~~~v~~~~~~~R~dG~~~~~~r~~~V~~~lVgDeTG~I~ftlW~e~~~~l~~Gd   91 (145)
T 1wjj_A           12 RKPVFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRKTRPASSLSRPSQPSRIVECLIGDETGCILFTARNDQVDLMKPGA   91 (145)
T ss_dssp             CCCSSCCSTTCCTTCCCEEEEEEEEEEEECCSSSSCCSCSSCCSSCCCCCCCEEEEEECSSCEEEEEECTTHHHHTCTTC
T ss_pred             cCccceEHHHcCCCCCceEEEEEEEEcccccccccccccCCccccccCCceEEEEEEEcCCcEEEEEEecCCcCcCCCCC
Confidence            4556789999999999999999999998775   32 2 44        3799999999999999999999888899999


Q ss_pred             EEEEeeeEEEEECCEEEEEEcCCceEEEecCceeeecCCCCCCCCCCCCCC
Q psy3603          95 IVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPV  145 (264)
Q Consensus        95 IIrI~ngyVs~frG~LqL~Igr~G~IekVgEf~~~fnE~pNiSe~~Pe~~~  145 (264)
                      +|+|+|||+++|+|+|+|+++++|.|+++++|+|+|+|.+|||++.||...
T Consensus        92 ~v~i~na~v~~~~G~~~L~vgk~g~Ie~~~e~~~~v~e~~n~S~~e~e~~~  142 (145)
T 1wjj_A           92 TVILRNSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLSLVEYESGP  142 (145)
T ss_dssp             EEEEEEEEEEEETTEEEEEECTTCCBCCCSCCCSCCCTTSBTTTSCCSSCC
T ss_pred             EEEEeccEEEeECCEEEEEECCCEEEEECCCCcEEEecCCCcCcceEEEee
Confidence            999999999999999999999999999999999999999999999998754
>1o7i_A SSB, SSO2364, single stranded DNA binding protein; OB fold; 1.2A {Sulfolobus solfataricus} SCOP: b.40.4.3 Back     alignment and structure
>2k75_A Uncharacterized protein TA0387; closed beta barrel, OB fold, structural genomics, PSI-2, protein structure initiative; NMR {Thermoplasma acidophilum} Back     alignment and structure
>2kbn_A Conserved protein; nucleic acid binding protein, beta barrel, structural genomics, PSI-2, protein structure initiative; NMR {Methanosarcina mazei} PDB: 2ken_A Back     alignment and structure
>3e0e_A Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A Back     alignment and structure
>3dm3_A Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>2k50_A Replication factor A related protein; uncharacterized protein, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>1ynx_A Replication factor-A protein 1; canonical OB fold, DNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1jmc_A Protein (replication protein A (RPA)); human ssDNA binding replication protein A(RPA), single stranded DNA-binding protein, protein-ssDNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 1fgu_A Back     alignment and structure
>4gop_B Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>4gop_C Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>1jmc_A Protein (replication protein A (RPA)); human ssDNA binding replication protein A(RPA), single stranded DNA-binding protein, protein-ssDNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 1fgu_A Back     alignment and structure
>3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 2pqa_A 1quq_A 1l1o_B Back     alignment and structure
>4gop_C Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Back     alignment and structure
>1xjv_A Protection of telomeres 1; protein-DNA complex, single-stranded DNA, transcription/DNA complex; 1.73A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 3kjo_A 3kjp_A Back     alignment and structure
>1qzg_A Protection of telomeres protein 1; protrein-DNA complex, single-stranded telomeric DNA, DNA binding protein/DNA complex; HET: TMP; 1.90A {Schizosaccharomyces pombe} SCOP: b.40.4.3 PDB: 1qzh_A Back     alignment and structure
>1jb7_A Telomere-binding protein alpha subunit; DNA-protein interactions, DNA HYDR sodium ION, quadruplex DNA, DNA-binding protein-DNA complex; 1.86A {Sterkiella nova} SCOP: b.40.4.3 b.40.4.3 b.40.4.3 PDB: 1kix_A 1otc_A* 2i0q_A 1ph6_A 1ph1_A 1phj_A* 1ph3_A 1pa6_A 1ph4_A 1ph7_A 1ph8_A 1ph9_A 1ph5_A* 1ph2_A* 1k8g_A Back     alignment and structure
>3kf6_A Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1xjv_A Protection of telomeres 1; protein-DNA complex, single-stranded DNA, transcription/DNA complex; 1.73A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 3kjo_A 3kjp_A Back     alignment and structure
>4hik_A Protection of telomeres protein 1; specificity, plasticity, promiscuity, OB-fold, ssDNA binding stranded telomeric DNA; HET: DNA; 1.64A {Schizosaccharomyces pombe} PDB: 4hid_A* 4him_A* 4hio_A* 4hj5_A* 4hj7_A* 4hj8_A* 4hj9_A* 4hja_A* Back     alignment and structure
>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C, DNA polymerase III; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
>1txy_A Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} SCOP: b.40.4.3 PDB: 1woc_A 2pnh_A 4apv_A Back     alignment and structure
>3rn5_A Interferon-inducible protein AIM2; OB fold, DNA binding, cytosolic, immune system-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 3rn2_A* Back     alignment and structure
>3ebe_A Protein MCM10 homolog; OB-fold, zinc finger, CCCH, DNA replication, metal-binding, zinc-finger, replication; 2.30A {Xenopus laevis} PDB: 3h15_A Back     alignment and structure
>3fhw_A Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Back     alignment and structure
>3au7_A TIAS, putative uncharacterized protein; ATP hydrolysis, RNA binding protein; 2.60A {Archaeoglobus fulgidus} PDB: 3amt_A* 3amu_A* Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold, transferase; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
>3koj_A Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>3k8a_A Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090} Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure
>3u4v_A Telomerase-associated protein 82; TEB1, processivity factor, DNA BIND protein; 1.80A {Tetrahymena thermophila} Back     alignment and structure
>3en2_A Probable primosomal replication protein N; PRIB RSR213C NESG X-RAY Q8XZT7 Q8XZT7_ralso, structural genomics, PSI-2; 2.30A {Ralstonia solanacearum} Back     alignment and structure
>4gs3_A Single-stranded DNA-binding protein; primosome, oligonucleotide/oligosaccharide binding domain, D binding protein; 1.09A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>2vw9_A Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Back     alignment and structure
>2oq0_A Gamma-interferon-inducible protein IFI-16; OB folds, beta-barrels, structural genomics, PSI-2, protein initiative; 2.00A {Homo sapiens} SCOP: b.40.16.1 b.40.16.1 Back     alignment and structure
>1qvc_A Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli} SCOP: b.40.4.3 PDB: 1kaw_A 1eyg_A 1sru_A Back     alignment and structure
>3rlo_A Gamma-interferon-inducible protein 16; HIN200/OB fold/DNA binding, DNA binding/cytosolic DNA sensor cytosol, DNA binding protein; 1.80A {Homo sapiens} PDB: 3rnu_A* 3b6y_A 3rln_A Back     alignment and structure
>3afp_A Single-stranded DNA-binding protein; OB-fold, quaternary structure and stability, changes on oligomerisation, water-bridges, DNA damage; 2.05A {Mycobacterium leprae} PDB: 3afq_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A 1x3e_A 1x3f_A 1x3g_A 3a5u_A* Back     alignment and structure
>1z9f_A Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural GENO joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3tqy_A Single-stranded DNA-binding protein; DNA replication, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3vdy_A SSB, single-stranded DNA-binding protein SSBB; OB fold; 2.80A {Bacillus subtilis} Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure
>3kf8_A Protein STN1; OB fold; 2.40A {Candida tropicalis mya-3404} Back     alignment and structure
>3ulp_A Single-strand binding protein; OB-fold, DNA binding, single-stranded DNA, apicoplast, DNA B protein-DNA complex; HET: DNA; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1v1q_A Primosomal replication protein N; primosome, DNA replication, DNA binding; 2.1A {Escherichia coli} SCOP: b.40.4.3 PDB: 2ccz_A Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Back     alignment and structure
>3ull_A DNA binding protein; DNA replication, mitochondrion, transit peptide; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 PDB: 1s3o_A* 2dud_A Back     alignment and structure
>3eiv_A Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>4dam_A Single-stranded DNA-binding protein 1; OB-fold; 1.70A {Streptomyces coelicolor} Back     alignment and structure
>1eqq_A Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli} SCOP: b.40.4.3 Back     alignment and structure
>3lgj_A Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae} Back     alignment and structure
>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Back     alignment and structure
>3k7u_C MP18 RNA editing complex protein; OB-fold, RNA-editing proteins, kinetoplastids, system, RNA binding protein; 2.10A {Trypanosoma brucei} PDB: 3k80_D 3stb_D Back     alignment and structure
>3pgz_A Single-stranded DNA-binding protein; ssgcid, single-strand binding protein, structural genomics center for infectious disease; 2.10A {Bartonella henselae} Back     alignment and structure
>3u58_A Tetrahymena TEB1 AB; tetrahymena, telomerase, TEB1, processivity factor, DNA BIND protein-DNA complex; HET: DNA; 2.61A {Tetrahymena thermophila} Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>1nnx_A Protein YGIW; structural genomics, hypothetical protein, OB-fold, structure 2 function project, S2F, unknown function; 1.45A {Escherichia coli} SCOP: b.40.10.1 Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Back     alignment and structure
>1jb7_A Telomere-binding protein alpha subunit; DNA-protein interactions, DNA HYDR sodium ION, quadruplex DNA, DNA-binding protein-DNA complex; 1.86A {Sterkiella nova} SCOP: b.40.4.3 b.40.4.3 b.40.4.3 PDB: 1kix_A 1otc_A* 2i0q_A 1ph6_A 1ph1_A 1phj_A* 1ph3_A 1pa6_A 1ph4_A 1ph7_A 1ph8_A 1ph9_A 1ph5_A* 1ph2_A* 1k8g_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 264
d1wjja_145 b.40.4.3 (A:) Hypothetical protein At4g28440 (F20O 1e-26
d1o7ia_115 b.40.4.3 (A:) Archaeal ssDNA-binding protein {Arch 7e-25
d1xjva1140 b.40.4.3 (A:6-145) Protection of telomeres protein 8e-05
>d1wjja_ b.40.4.3 (A:) Hypothetical protein At4g28440 (F20O9.120) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Single strand DNA-binding domain, SSB
domain: Hypothetical protein At4g28440 (F20O9.120)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 98.9 bits (246), Expect = 1e-26
 Identities = 24/124 (19%), Positives = 47/124 (37%), Gaps = 13/124 (10%)

Query: 27  KKEAMDVYIKDLHVGIKNVNVTCIVLDISPRVT-------------LKENREVRTLKVAD 73
           K++ + V ++ L  G     +T  V++ +  V                +   +    + D
Sbjct: 11  KRKPVFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRKTRPASSLSRPSQPSRIVECLIGD 70

Query: 74  STACINLSLWDEPGALLHPGDIVRLTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNEN 133
            T CI  +  ++   L+ PG  V L      +++  + L   K G IE  G       E+
Sbjct: 71  ETGCILFTARNDQVDLMKPGATVILRNSRIDMFKGTMRLGVDKWGRIEATGAASFTVKED 130

Query: 134 LDMS 137
            ++S
Sbjct: 131 NNLS 134
>d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 115 Back     information, alignment and structure
>d1xjva1 b.40.4.3 (A:6-145) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
d1wjja_145 Hypothetical protein At4g28440 (F20O9.120) {Thale 99.91
d1o7ia_115 Archaeal ssDNA-binding protein {Archaeon Sulfolobu 99.89
d1jmca1116 Replication protein A 70 KDa subunit (RPA70) {Huma 99.37
d1jmca2122 Replication protein A 70 KDa subunit (RPA70) {Huma 99.02
d1xjva1140 Protection of telomeres protein 1, Pot1 {Human (Ho 98.78
d1jb7a1169 Telomere end binding protein alpha subunit {Oxytri 98.64
d1qzga_170 Protection of telomeres protein 1, Pot1 {Fission y 98.34
d2pi2a1128 Replication protein A 32 KDa subunit (RPA32) fragm 98.11
d1n9wa193 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 97.34
d2oq0a188 Gamma-interferon-inducible protein Ifi-16 {Human ( 97.07
d1qvca_145 ssDNA-binding protein {Escherichia coli [TaxId: 56 96.93
d1gm5a2180 RecG "wedge" domain {Thermotoga maritima [TaxId: 2 96.93
d1xjva2151 Protection of telomeres protein 1, Pot1 {Human (Ho 96.85
d1v1qa_111 Primosomal replication protein N, PriB {Escherichi 96.63
d1eova1134 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 96.43
d1e1oa1143 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 95.58
d1jb7a2124 Telomere end binding protein alpha subunit {Oxytri 94.99
d1ue1a_118 ssDNA-binding protein {Mycobacterium tuberculosis 94.37
d1b8aa1103 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 93.84
d3ulla_115 ssDNA-binding protein {Human (Homo sapiens), mitoc 92.89
d1se8a_231 ssDNA-binding protein {Deinococcus radiodurans [Ta 92.6
d1se8a_231 ssDNA-binding protein {Deinococcus radiodurans [Ta 92.08
d1l0wa1104 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 90.0
d1c0aa1106 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 89.63
d1iyjb4111 OB-fold domains of BRCA2 {Rat (Rattus norvegicus) 87.35
d1nnxa_106 Hypothetical protein YgiW {Escherichia coli [TaxId 86.21
>d1wjja_ b.40.4.3 (A:) Hypothetical protein At4g28440 (F20O9.120) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Single strand DNA-binding domain, SSB
domain: Hypothetical protein At4g28440 (F20O9.120)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.91  E-value=4.8e-25  Score=182.17  Aligned_cols=116  Identities=20%  Similarity=0.291  Sum_probs=106.3

Q ss_pred             cccccccccccccceEEEEEEEecCCcee-----------ecCC--cEEEEEEEEeCCCeEEEEEecCCCCCCCCCCEEE
Q psy3603          31 MDVYIKDLHVGIKNVNVTCIVLDISPRVT-----------LKEN--REVRTLKVADSTACINLSLWDEPGALLHPGDIVR   97 (264)
Q Consensus        31 ~~ikIkDLkpG~knVnv~fiVle~~~~r~-----------TKdG--g~V~tL~LADeTGsI~ltLWdd~ad~Ik~GDIIr   97 (264)
                      .+.+|+||+|++++|+++++|+++.++++           +++|  ..+.+++|+|+||+|++++|++.++.|++||+|+
T Consensus        15 ~~~kI~dL~pg~~~vnl~vkVl~~~~~~~~~r~~~~~~~~~~~g~~~~v~~~~v~DeTG~i~~tlW~~~~~~l~~Gd~v~   94 (145)
T d1wjja_          15 VFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRKTRPASSLSRPSQPSRIVECLIGDETGCILFTARNDQVDLMKPGATVI   94 (145)
T ss_dssp             SSCCSTTCCTTCCCEEEEEEEEEEEECCSSSSCCSCSSCCSSCCCCCCCEEEEEECSSCEEEEEECTTHHHHTCTTCEEE
T ss_pred             ceeEHHHCCCCCCCceEEEEEEEcccceeecccccccccccccCCCcEEEEEEEEccCCeEEEEEEeccccccCcCCEEE
Confidence            57899999999999999999999876543           2233  4689999999999999999999888899999999


Q ss_pred             EeeeEEEEECCEEEEEEcCCceEEEecCceeeecCCCCCCCCCCCCCCC
Q psy3603          98 LTKCYAQIWRNCLTLYSSKSGLIEKIGEFCMVFNENLDMSIPIPNLPVN  146 (264)
Q Consensus        98 I~ngyVs~frG~LqL~Igr~G~IekVgEf~~~fnE~pNiSe~~Pe~~~~  146 (264)
                      |.|||+++|+|+|+|+++++|.|++++++++.+++.+|||+..+|..+.
T Consensus        95 i~na~v~~~~G~~~L~vg~~g~I~~~~e~~~~v~e~~niS~~e~E~~p~  143 (145)
T d1wjja_          95 LRNSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLSLVEYESGPS  143 (145)
T ss_dssp             EEEEEEEEETTEEEEEECTTCCBCCCSCCCSCCCTTSBTTTSCCSSCCS
T ss_pred             EeeEEEEEECCEEEEEECCCEEEEECCCCcccccccCCCceeEEecCCC
Confidence            9999999999999999999999999999999999999999999998764
>d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmca2 b.40.4.3 (A:299-420) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjva1 b.40.4.3 (A:6-145) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jb7a1 b.40.4.3 (A:36-204) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]} Back     information, alignment and structure
>d1qzga_ b.40.4.3 (A:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2pi2a1 b.40.4.3 (A:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d2oq0a1 b.40.16.1 (A:115-202) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvca_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xjva2 b.40.4.3 (A:149-299) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e1oa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1jb7a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]} Back     information, alignment and structure
>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]} Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyjb4 b.40.4.3 (B:2732-2760,B:2898-2979) OB-fold domains of BRCA2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nnxa_ b.40.10.1 (A:) Hypothetical protein YgiW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure