Diaphorina citri psyllid: psy3616

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
VCKGYCENKGTCVKDARGQPSCRCVGSFIGPHCAQKSEFAYIAGGIAATVVFLIIIALFVWMICARSERRREPKKLVAQTNDQTGSQVNFYYGGAPYAESVAPSHHSTYAHYYDDEEDGWEMPNFYNETYMKGEYRARNFSAV
ccccccccccEECcccccccCEEEcccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEECcccccccccccccccccccccccccccccccccccccHHHccccccccccc
VCKGYCENKGTCVKDARGQPSCRCVGSFIGPHCAQKSEFAYIAGGIAATVVFLIIIALFVWMICARS*******************QVNFYYGGAPYAESVAPSHHSTYAHYYDDEEDGWEMPNFYNETYMKG**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VCKGYCENKGTCVKDARGQPSCRCVGSFIGPHCAQKSEFAYIAGGIAATVVFLIIIALFVWMICARSERRREPKKLVAQTNDQTGSQVNFYYGGAPYAESVAPSHHSTYAHYYDDEEDGWEMPNFYNETYMKGEYRARNFSAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0046716 [BP]muscle cell homeostasisprobableGO:0019725, GO:0060249, GO:0009987, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0065008, GO:0044699
GO:0035152 [BP]regulation of tube architecture, open tracheal systemprobableGO:0060541, GO:0007424, GO:0032501, GO:0044707, GO:0048856, GO:0032502, GO:0065007, GO:0048731, GO:0008150, GO:0065008, GO:0007275, GO:0044699
GO:0045746 [BP]negative regulation of Notch signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NQL, chain B
Confidence level:confident
Coverage over the Query: 3-37
View the alignment between query and template
View the model in PyMOL
Template: 2K9J, chain B
Confidence level:probable
Coverage over the Query: 33-48
View the alignment between query and template
View the model in PyMOL