Diaphorina citri psyllid: psy3626


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MKKIAIFGATGMTGLCSLEAALKQGLEVCTLLRDPQRLPSEYHSKVEIIQGDVLKLADVKKAIEGKDGLEVCTLLRDPQRLPSEYHSKVEIIQGDVLKLADVKKAIEGKDGVVVALGTRNDLSPTTVMSEGMKNIVTAMKEYNVSVVSVCLSAFLFYEPSKVPPMFHNVNDDHQRMYNVLKDSGLNYIA
ccEEEEEccccHHHHHHHHHHHHccccEEEEECccccccccccccCEEEEcccccHHHHHHHHccccccEEEEccccccccccccccccHHHHcccccHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHccccccc
MKKIAIFGATGMTGLCSLEAALKQGLEVCTLLRDPQRLPSEYHSKVEIIQGDVLKLADVKKAIEGKDGLEVCTLLRDPQRLPSEYHSKVEIIQGDVLKLADVKKAIEGKDGVVVALGTRNDLSPTTVMSEGMKNIVTAMKEYNVSVVSVCLSAFLFYEPSKVPPMFHNVNDDHQRMYNVLKDSGLNYIA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKIAIFGATGMTGLCSLEAALKQGLEVCTLLRDPQRLPSEYHSKVEIIQGDVLKLADVKKAIEGKDGLEVCTLLRDPQRLPSEYHSKVEIIQGDVLKLADVKKAIEGKDGVVVALGTRNDLSPTTVMSEGMKNIVTAMKEYNVSVVSVCLSAFLFYEPSKVPPMFHNVNDDHQRMYNVLKDSGLNYIA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flavin reductase (NADPH) Broad specificity oxidoreductase that catalyzes the NADPH-dependent reduction of a variety of flavins, such as riboflavin, FAD or FMN, biliverdins, methemoglobin and PQQ (pyrroloquinoline quinone). Contributes to heme catabolism and metabolizes linear tetrapyrroles. Can also reduce the complexed Fe(3+) iron to Fe(2+) in the presence of FMN and NADPH. In the liver, converts biliverdin to bilirubin.confidentP52556
Flavin reductase (NADPH) Broad specificity oxidoreductase that catalyzes the NADPH-dependent reduction of a variety of flavins, such as riboflavin, FAD or FMN, biliverdins, methemoglobin and PQQ (pyrroloquinoline quinone). Contributes to heme catabolism and metabolizes linear tetrapyrroles. Can also reduce the complexed Fe(3+) iron to Fe(2+) in the presence of FMN and NADPH. In the liver, converts biliverdin to bilirubin.confidentP30043
Flavin reductase (NADPH) Broad specificity oxidoreductase that catalyzes the NADPH-dependent reduction of a variety of flavins, such as riboflavin, FAD or FMN, biliverdins, methemoglobin and PQQ (pyrroloquinoline quinone). Contributes to heme catabolism and metabolizes linear tetrapyrroles. Can also reduce the complexed Fe(3+) iron to Fe(2+) in the presence of FMN and NADPH. In the liver, converts biliverdin to bilirubin.confidentQ923D2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0042602 [MF]riboflavin reductase (NADPH) activityprobableGO:0003824, GO:0003674, GO:0016646, GO:0016645, GO:0016491
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0004074 [MF]biliverdin reductase activityprobableGO:0003824, GO:0016627, GO:0003674, GO:0016628, GO:0016491
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0042167 [BP]heme catabolic processprobableGO:0006778, GO:0044248, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0051187, GO:0051186, GO:0042440, GO:0046149, GO:0006787, GO:0071704, GO:0033015, GO:0033013, GO:1901575, GO:0046483, GO:0042168, GO:0009987, GO:0006725, GO:0044710, GO:0046700, GO:0008150, GO:0008152, GO:0009056, GO:1901565, GO:1901564, GO:0044270, GO:0044237, GO:0019439
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HDO, chain A
Confidence level:very confident
Coverage over the Query: 2-58,102-189
View the alignment between query and template
View the model in PyMOL
Template: 1QYC, chain A
Confidence level:very confident
Coverage over the Query: 1-44,55-64,86-189
View the alignment between query and template
View the model in PyMOL