Diaphorina citri psyllid: psy3629

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36

MDGVERLNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSYKKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKATNKVEVDPQALEKLCITRADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKDTESSGLVSVLLEVDKVPTDELSLSNFAAANKDDFVEDTKHIEVTTGPGRHYIFTLAYSPDVKRGFIGFSLLQRKWAELSLHQDIDVKPFFFNPKNTSEFLCTIILEAGPNSGLHIIIFDEIDAICKARGTAGGNTGVHDTVVNQLLSKMDGVERLNNILVIGMTNRRDMIDEALLRPGRLEVSEI

cccccccccEEEEEEccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccEEEEEccccccccccccHHHHHHHHHccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccc

MDGVERLNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSYKKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKATNKVEVDPQALEKLCITRADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKDTESSGLVSVLLEVDKVPTDELSLSNFAAANKDDFVEDTKHIEVTTGPGRHYIFTLAYSPDVKRGFIGFSLLQRKWAELSLHQDIDVKPFFFNPKNTSEFLCTIILEAGPNSGLHIIIFDEIDAICKAR*****NTGVHDTVVNQLLSKMDGVERLNNILVIGMTNRRDMIDEALLRPGRLEVSEI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vesicle-fusing ATPase 2	Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.	confident	P54351
Vesicular-fusion protein sec18	Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.	confident	Q9P7Q4
Vesicle-fusing ATPase	Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.	confident	Q94392

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031201 [CC]	SNARE complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425
GO:0048172 [BP]	regulation of short-term neuronal synaptic plasticity	probable	GO:0010646, GO:0044057, GO:0031644, GO:0050804, GO:0050789, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0065008, GO:0048168, GO:0050794
GO:0035494 [BP]	SNARE complex disassembly	probable	GO:0032984, GO:0051234, GO:0016192, GO:0071822, GO:0043933, GO:0006810, GO:0044763, GO:0016043, GO:0022411, GO:0071840, GO:0008150, GO:0009987, GO:0043624, GO:0043241, GO:0051179, GO:0044699
GO:0043623 [BP]	cellular protein complex assembly	probable	GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0071840
GO:0030496 [CC]	midbody	probable	GO:0005575, GO:0044464, GO:0005623
GO:0006911 [BP]	phagocytosis, engulfment	probable	GO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0042144 [BP]	vacuole fusion, non-autophagic	probable	GO:0006996, GO:0007033, GO:0016044, GO:0071840, GO:0009987, GO:0016043, GO:0061025, GO:0061024, GO:0044763, GO:0006944, GO:0008150, GO:0044699
GO:0048280 [BP]	vesicle fusion with Golgi apparatus	probable	GO:0006906, GO:0061025, GO:0061024, GO:0006944, GO:0044699, GO:0016044, GO:0016043, GO:0071840, GO:0009987, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0006996, GO:0016192, GO:0046907, GO:0016050, GO:0048284, GO:0044763
GO:0007274 [BP]	neuromuscular synaptic transmission	probable	GO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032403 [MF]	protein complex binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0007030 [BP]	Golgi organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0043198 [CC]	dendritic shaft	probable	GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0006813 [BP]	potassium ion transport	probable	GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0030165 [MF]	PDZ domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0015031 [BP]	protein transport	probable	GO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179
GO:0016482 [BP]	cytoplasmic transport	probable	GO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0043332 [CC]	mating projection tip	probable	GO:0044464, GO:0044463, GO:0030427, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0007269 [BP]	neurotransmitter secretion	probable	GO:0019226, GO:0035637, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0044699, GO:0065007, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0044707, GO:0008150, GO:0006836
GO:0006887 [BP]	exocytosis	probable	GO:0046903, GO:0009987, GO:0016192, GO:0006810, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0019905 [MF]	syntaxin binding	probable	GO:0000149, GO:0003674, GO:0005488, GO:0005515
GO:0005795 [CC]	Golgi stack	probable	GO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0008582 [BP]	regulation of synaptic growth at neuromuscular junction	probable	GO:0048638, GO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0048634, GO:0051128, GO:0032501, GO:0023052, GO:0051147, GO:0050789, GO:0044699, GO:0040008, GO:0060284, GO:0065007, GO:0048641, GO:0065008, GO:1901861, GO:0016202, GO:0009987, GO:0050793, GO:0050877, GO:0048742, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051963, GO:0044087, GO:0051960, GO:2000026, GO:0044763
GO:0017137 [MF]	Rab GTPase binding	probable	GO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0048211 [BP]	Golgi vesicle docking	probable	GO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0022406, GO:0048278, GO:0044765, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016887 [MF]	ATPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0001921 [BP]	positive regulation of receptor recycling	probable	GO:0010604, GO:0019222, GO:0060255, GO:0031325, GO:0031323, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0001919, GO:0048522, GO:0050789, GO:0009893
GO:0051648 [BP]	vesicle localization	probable	GO:0009987, GO:0044763, GO:0051640, GO:0008150, GO:0051179, GO:0044699, GO:0051641

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DHR, chain A
Confidence level:very confident
Coverage over the Query: 1-98,114-134
View the alignment between query and template
View the model in PyMOL

Template: 1D2N, chain A
Confidence level:very confident
Coverage over the Query: 140-203,219-245,270-356
View the alignment between query and template
View the model in PyMOL

Template: 3CF2, chain A
Confidence level:very confident
Coverage over the Query: 1-203,219-245,259-260,276-297,311-357
View the alignment between query and template
View the model in PyMOL

Template: 1R7R, chain A
Confidence level:confident
Coverage over the Query: 1-123,148-354
View the alignment between query and template
View the model in PyMOL