Psyllid ID: psy3629

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36

MDGVERLNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSYKKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKATNKVEVDPQALEKLCITRADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKDTESSGLVSVLLEVDKVPTDELSLSNFAAANKDDFVEDTKHIEVTTGPGRHYIFTLAYSPDVKRGFIGFSLLQRKWAELSLHQDIDVKPFFFNPKNTSEFLCTIILEAGPNSGLHIIIFDEIDAICKARGTAGGNTGVHDTVVNQLLSKMDGVERLNNILVIGMTNRRDMIDEALLRPGRLEVSEI

cccccccccEEEEEEccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccEEEEEccccccccccccHHHHHHHHHccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccc

cccccccccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHccccHHHHccccccHHHHHHHHHcccccccccEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccHHccccHHHHHHHHHHHHccHHcHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHccccEEEHHHHHHHHccHHHHHHHHHHHHHHHcccEEEEEEcHHHHcccccccccccccHHHHHHHHHHHHcccHccccEEEEEEccccccccHHHHccccccHHHc

MDGVERLNNILVIGMTNRRDMideallrpgrlelqmeislpnedgRVQILQIHTAKMRSYKKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKatnkvevdpQALEKLCITRADFLHALEtdikpafgssdeSLEHFLSRGILNWGTPVQECLEAGRIFiqqskdtessGLVSVLLEvdkvptdelslsnfaaankddfvedtkhievttgpgrhyiftlayspdvkrgfIGFSLLQRKWAELslhqdidvkpfffnpkntsEFLCTIILeagpnsglhiIIFDEIDAICKArgtaggntgvHDTVVNQLLSKMDGVERLNNILVIGMTNRRDMIDeallrpgrlevsei

MDGVERLNNIlvigmtnrrdmIDEALLRPGRLELQMeislpnedgRVQILQIHTAKMRSYKKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKatnkvevdpqALEKLCITRADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKDTESSGLVSVLLEVDKVPTDELSLSNfaaankddfveDTKHIevttgpgrhyIFTLAYSPDVKRGFIGFSLLQRKWAELSLHQDIDVKPFFFNPKNTSEFLCTIILEAGPNSGLHIIIFDEIDAICKARGTAGGNTGVHDTVVNQLLSKMDGVERLNNILVigmtnrrdmideallrpgrlevsei

******LNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSYKKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKATNKVEVDPQALEKLCITRADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQS*****SGLVSVLLEVDKVPTDELSLSNFAAANKDDFVEDTKHIEVTTGPGRHYIFTLAYSPDVKRGFIGFSLLQRKWAELSLHQDIDVKPFFFNPKNTSEFLCTIILEAGPNSGLHIIIFDEIDAICKARGTAGGNTGVHDTVVNQLLSKMDGVERLNNILVIGMTNRRDMIDEAL***********

MDGVERLNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSYKKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLI**************KLCITRADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKDTESSGLVSVLLEVDKVPTDELSLSNFAAANKDDFVEDTKHIEVTTGPGRHYIFTLAYSPDVKRGFIGFSLLQRKWAELSLHQDIDVKPFFFNPKNTSEFLCTIILEAGPNSGLHIIIFDEIDAI****************VVNQLLSKMDGVERLNNILVIGMTNRRDMIDEALLRPGRLEVSEI

*****RLNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSYKKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKATNKVEVDPQALEKLCITRADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKDTESSGLVSVLLEVDKVPTDELSLSNFAAANKDDFVEDTKHIEVTTGPGRHYIFTLAYSPDVKRGFIGFSLLQRKWAELSLHQDIDVKPFFFNPKNTSEFLCTIILEAGPNSGLHIIIFDEIDAICKAR*****NTGVHDTVVNQLLSKMDGVERLNNILVIGMTNRRDMIDEALLRPGRLEV**I

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		358	2.2.26 [Sep-21-2011]
P54351		752	Vesicle-fusing ATPase 2 O	yes	N/A	0.511	0.243	0.751	9e-76
P46461		745	Vesicle-fusing ATPase 1 O	no	N/A	0.513	0.246	0.722	2e-73
Q94392		824	Vesicle-fusing ATPase OS=	yes	N/A	0.502	0.218	0.652	1e-64
P18708		744	Vesicle-fusing ATPase OS=	yes	N/A	0.513	0.247	0.637	4e-63
P46459		744	Vesicle-fusing ATPase OS=	yes	N/A	0.513	0.247	0.637	5e-63
P46460		744	Vesicle-fusing ATPase OS=	yes	N/A	0.513	0.247	0.637	5e-63
Q9QUL6		744	Vesicle-fusing ATPase OS=	yes	N/A	0.513	0.247	0.637	5e-63
Q5R410		744	Vesicle-fusing ATPase OS=	yes	N/A	0.513	0.247	0.637	6e-63
Q9P7Q4		792	Vesicular-fusion protein	yes	N/A	0.508	0.229	0.559	2e-51
P18759		758	Vesicular-fusion protein	yes	N/A	0.511	0.241	0.513	1e-46

>sp\|P54351\|NSF2_DROME Vesicle-fusing ATPase 2 OS=Drosophila melanogaster GN=Nsf2 PE=2 SV=2	Back alignment and function desciption

 Score =  284 bits (726), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 161/185 (87%)

Query: 1   MDGVERLNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSY 60
           +DGVE+LNNILVIGMTNRRDMIDEALLRPGRLE+QMEISLPNE GRVQIL IHT +MR +
Sbjct: 363 IDGVEQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMRDF 422

Query: 61  KKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKATNKVEVDPQALEKLCITR 120
            K+A DV+  E+AA TKNFSGAELEGLVRAAQS AMNRLIKA +KV VDP+A+EKL +TR
Sbjct: 423 NKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLRVTR 482

Query: 121 ADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKDTESSGLV 180
           ADFLHAL+ DIKPAFG++ E LE+ L+RGI+NWG PV E LE G + +QQ+K TESSGLV
Sbjct: 483 ADFLHALDNDIKPAFGAAQEMLENLLARGIINWGPPVTELLEDGMLSVQQAKATESSGLV 542

Query: 181 SVLLE 185
           SVL+E
Sbjct: 543 SVLIE 547

Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 6

>sp\|P46461\|NSF1_DROME Vesicle-fusing ATPase 1 OS=Drosophila melanogaster GN=comt PE=2 SV=1	Back alignment and function description

>sp\|Q94392\|NSF_CAEEL Vesicle-fusing ATPase OS=Caenorhabditis elegans GN=nsf-1 PE=1 SV=2	Back alignment and function description

>sp\|P18708\|NSF_CRIGR Vesicle-fusing ATPase OS=Cricetulus griseus GN=NSF PE=1 SV=1	Back alignment and function description

>sp\|P46459\|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3	Back alignment and function description

>sp\|P46460\|NSF_MOUSE Vesicle-fusing ATPase OS=Mus musculus GN=Nsf PE=1 SV=2	Back alignment and function description

>sp\|Q9QUL6\|NSF_RAT Vesicle-fusing ATPase OS=Rattus norvegicus GN=Nsf PE=1 SV=1	Back alignment and function description

>sp\|Q5R410\|NSF_PONAB Vesicle-fusing ATPase OS=Pongo abelii GN=NSF PE=2 SV=1	Back alignment and function description

>sp\|Q9P7Q4\|SEC18_SCHPO Vesicular-fusion protein sec18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec18 PE=1 SV=1	Back alignment and function description

>sp\|P18759\|SEC18_YEAST Vesicular-fusion protein SEC18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC18 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		358
57903680		732	N-ethylmaleimide sensitive fusion protei	0.508	0.248	0.756	1e-77
357619681		746	N-ethylmaleimide sensitive fusion protei	0.508	0.243	0.751	5e-77
350403605		743	PREDICTED: vesicle-fusing ATPase 1-like	0.516	0.248	0.756	2e-76
340722867		744	PREDICTED: vesicle-fusing ATPase 1-like	0.516	0.248	0.756	2e-76
328793374		773	PREDICTED: vesicle-fusing ATPase 1-like	0.516	0.239	0.756	3e-76
380019699		743	PREDICTED: vesicle-fusing ATPase 1-like	0.516	0.248	0.751	9e-76
270013652		740	hypothetical protein TcasGA2_TC012279 [T	0.502	0.243	0.751	1e-75
189240658		1137	PREDICTED: similar to N-ethylmaleimide s	0.502	0.158	0.751	3e-75
229576829		744	vesicle-fusing ATPase [Nasonia vitripenn	0.513	0.247	0.751	3e-75
383865180		743	PREDICTED: vesicle-fusing ATPase 1-like	0.516	0.248	0.745	5e-75

>gi\|57903680\|gb\|AAW58140.1\| N-ethylmaleimide sensitive fusion protein [Helicoverpa armigera]	Back alignment and taxonomy information

 Score =  296 bits (758), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 140/185 (75%), Positives = 168/185 (90%)

Query: 1   MDGVERLNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSY 60
           +DGV++LNNILVIGMTNRRDMIDEAL+RPGRLE+QMEI LP+E+GRVQIL IHT +M+ Y
Sbjct: 358 IDGVDQLNNILVIGMTNRRDMIDEALMRPGRLEVQMEIGLPDENGRVQILNIHTKRMKEY 417

Query: 61  KKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKATNKVEVDPQALEKLCITR 120
           KK+A+DV+ KELAALTKNFSGAELEGLVRAAQS AMNRLIKA++KVEVDP+A+EKL + R
Sbjct: 418 KKIAEDVDSKELAALTKNFSGAELEGLVRAAQSTAMNRLIKASSKVEVDPEAMEKLMVER 477

Query: 121 ADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKDTESSGLV 180
            DFLHALE DIKP FG++ E+LEHFLSRGI+NWG+PV   LE G+++IQQ++ TE+SGLV
Sbjct: 478 GDFLHALENDIKPTFGTAAEALEHFLSRGIINWGSPVSSLLEDGQLYIQQARATEASGLV 537

Query: 181 SVLLE 185
           SVLLE
Sbjct: 538 SVLLE 542

Source: Helicoverpa armigera

Species: Helicoverpa armigera

Genus: Helicoverpa

Family: Noctuidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|357619681\|gb\|EHJ72156.1\| N-ethylmaleimide sensitive fusion protein [Danaus plexippus]	Back alignment and taxonomy information

>gi\|350403605\|ref\|XP_003486851.1\| PREDICTED: vesicle-fusing ATPase 1-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|340722867\|ref\|XP_003399822.1\| PREDICTED: vesicle-fusing ATPase 1-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|328793374\|ref\|XP_001120201.2\| PREDICTED: vesicle-fusing ATPase 1-like isoform 2 [Apis mellifera]	Back alignment and taxonomy information

>gi\|380019699\|ref\|XP_003693740.1\| PREDICTED: vesicle-fusing ATPase 1-like [Apis florea]	Back alignment and taxonomy information

>gi\|270013652\|gb\|EFA10100.1\| hypothetical protein TcasGA2_TC012279 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|189240658\|ref\|XP_001811586.1\| PREDICTED: similar to N-ethylmaleimide sensitive fusion protein [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|229576829\|ref\|NP_001153385.1\| vesicle-fusing ATPase [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|383865180\|ref\|XP_003708053.1\| PREDICTED: vesicle-fusing ATPase 1-like [Megachile rotundata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		358
FB\|FBgn0013998		752	Nsf2 "NEM-sensitive fusion pro	0.516	0.246	0.751	9.7e-72
FB\|FBgn0000346		745	comt "comatose" [Drosophila me	0.513	0.246	0.722	6.5e-67
ZFIN\|ZDB-GENE-030616-37		744	nsfa "N-ethylmaleimide-sensiti	0.516	0.248	0.643	1.3e-61
UNIPROTKB\|F1RRS3		752	NSF "Uncharacterized protein"	0.516	0.246	0.643	2.6e-61
UNIPROTKB\|E2RFV4		811	NSF "Uncharacterized protein"	0.516	0.228	0.643	2.6e-61
UNIPROTKB\|F1MZU2		746	NSF "Uncharacterized protein"	0.516	0.247	0.643	2.6e-61
UNIPROTKB\|F1P6Z3		745	NSF "Uncharacterized protein"	0.516	0.248	0.643	2.6e-61
MGI\|MGI:104560		744	Nsf "N-ethylmaleimide sensitiv	0.516	0.248	0.637	5.4e-61
RGD\|621594		744	Nsf "N-ethylmaleimide-sensitiv	0.516	0.248	0.637	5.4e-61
UNIPROTKB\|F1LQ81		744	Nsf "Vesicle-fusing ATPase" [R	0.516	0.248	0.637	5.4e-61

FB\|FBgn0013998 Nsf2 "NEM-sensitive fusion protein 2" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 704 (252.9 bits), Expect = 9.7e-72, Sum P(2) = 9.7e-72
 Identities = 139/185 (75%), Positives = 161/185 (87%)

Query:     1 MDGVERLNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSY 60
             +DGVE+LNNILVIGMTNRRDMIDEALLRPGRLE+QMEISLPNE GRVQIL IHT +MR +
Sbjct:   363 IDGVEQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMRDF 422

Query:    61 KKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKATNKVEVDPQALEKLCITR 120
              K+A DV+  E+AA TKNFSGAELEGLVRAAQS AMNRLIKA +KV VDP+A+EKL +TR
Sbjct:   423 NKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLRVTR 482

Query:   121 ADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKDTESSGLV 180
             ADFLHAL+ DIKPAFG++ E LE+ L+RGI+NWG PV E LE G + +QQ+K TESSGLV
Sbjct:   483 ADFLHALDNDIKPAFGAAQEMLENLLARGIINWGPPVTELLEDGMLSVQQAKATESSGLV 542

Query:   181 SVLLE 185
             SVL+E
Sbjct:   543 SVLIE 547

GO:0005737 "cytoplasm" evidence=ISS;NAS

GO:0007269 "neurotransmitter secretion" evidence=NAS

GO:0016082 "synaptic vesicle priming" evidence=NAS

GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=ISS;NAS

GO:0016192 "vesicle-mediated transport" evidence=NAS

GO:0006891 "intra-Golgi vesicle-mediated transport" evidence=NAS

GO:0007274 "neuromuscular synaptic transmission" evidence=IMP

GO:0008582 "regulation of synaptic growth at neuromuscular junction" evidence=IMP

GO:0005524 "ATP binding" evidence=IEA

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0031201 "SNARE complex" evidence=IDA

FB\|FBgn0000346 comt "comatose" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030616-37 nsfa "N-ethylmaleimide-sensitive factor a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RRS3 NSF "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RFV4 NSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MZU2 NSF "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P6Z3 NSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:104560 Nsf "N-ethylmaleimide sensitive fusion protein" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|621594 Nsf "N-ethylmaleimide-sensitive factor" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LQ81 Nsf "Vesicle-fusing ATPase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q75JI3	NSF_DICDI	3, ., 6, ., 4, ., 6	0.5107	0.5027	0.2439	yes	N/A
P18708	NSF_CRIGR	3, ., 6, ., 4, ., 6	0.6378	0.5139	0.2473	yes	N/A
P46460	NSF_MOUSE	3, ., 6, ., 4, ., 6	0.6378	0.5139	0.2473	yes	N/A
Q9P7Q4	SEC18_SCHPO	No assigned EC number	0.5597	0.5083	0.2297	yes	N/A
P54351	NSF2_DROME	3, ., 6, ., 4, ., 6	0.7513	0.5111	0.2433	yes	N/A
Q5R410	NSF_PONAB	3, ., 6, ., 4, ., 6	0.6378	0.5139	0.2473	yes	N/A
Q9M0Y8	NSF_ARATH	3, ., 6, ., 4, ., 6	0.5081	0.5083	0.2452	yes	N/A
P18759	SEC18_YEAST	No assigned EC number	0.5135	0.5111	0.2414	yes	N/A
P46459	NSF_HUMAN	3, ., 6, ., 4, ., 6	0.6378	0.5139	0.2473	yes	N/A
Q9QUL6	NSF_RAT	3, ., 6, ., 4, ., 6	0.6378	0.5139	0.2473	yes	N/A
Q94392	NSF_CAEEL	3, ., 6, ., 4, ., 6	0.6521	0.5027	0.2184	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		358
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	1e-42
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	2e-30
COG1222		406	COG1222, RPT1, ATP-dependent 26S proteasome regula	4e-28
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	8e-27
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	9e-25
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	3e-24
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	2e-22
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	7e-21
CHL00176		638	CHL00176, ftsH, cell division protein; Validated	2e-20
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	1e-18
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	1e-17
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	1e-16
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	7e-16
CHL00176		638	CHL00176, ftsH, cell division protein; Validated	5e-15
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	1e-14
COG1222		406	COG1222, RPT1, ATP-dependent 26S proteasome regula	2e-14
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	2e-14
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	5e-14
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	8e-14
PTZ00361		438	PTZ00361, PTZ00361, 26 proteosome regulatory subun	2e-13
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	7e-13
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	2e-12
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	6e-12
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	1e-11
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	1e-11
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	7e-10
smart01073		82	smart01073, CDC48_N, Cell division protein 48 (CDC	5e-09
PTZ00361		438	PTZ00361, PTZ00361, 26 proteosome regulatory subun	3e-08
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	4e-08
pfam02359		84	pfam02359, CDC48_N, Cell division protein 48 (CDC4	5e-08
CHL00195		489	CHL00195, ycf46, Ycf46; Provisional	6e-08
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	9e-08
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	4e-06
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	2e-05
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	3e-04

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

 Score =  157 bits (398), Expect = 1e-42
 Identities = 117/365 (32%), Positives = 170/365 (46%), Gaps = 67/365 (18%)

Query: 1   MDGVERLNNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSY 60
           MDG++    ++VIG TNR D +D AL RPGR + ++ I +P++  R +IL++HT  M   
Sbjct: 306 MDGLKGRGRVIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILKVHTRNM--- 362

Query: 61  KKLADDVNLKELAALTKNFSGAELEGLVRAAQSCAMNRLIKATNKVEVDPQA-------L 113
             LA+DV+L +LA +T  F GA+L  L + A   A+ R I    + +++ +A       L
Sbjct: 363 -PLAEDVDLDKLAEVTHGFVGADLAALAKEAAMAALRRFI---REGKINFEAEEIPAEVL 418

Query: 114 EKLCITRADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTPVQECLEAGRIFIQQSKD 173
           ++L +T  DF+ AL                                            K 
Sbjct: 419 KELKVTMKDFMEAL--------------------------------------------KM 434

Query: 174 TESSGLVSVLLEVDKVPTDELSLSNFAAANKDDFVE-DTKHIEVTTGPG-RHYIFTLAYS 231
            E S +  VL+EV  V   ++           + VE   KH E+    G R     L + 
Sbjct: 435 VEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLKHPEIFEKMGIRPPKGVLLFG 494

Query: 232 PDVKRGFIGFSLLQRKWAELSLHQDIDVK-PFFFNP-KNTSEFLCTIILEAGPNSGLHII 289
           P       G +LL +  A  S    I V+ P   +     SE     I      +   II
Sbjct: 495 PPGT----GKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRKARQAAPAII 550

Query: 290 IFDEIDAICKARGTAGGNTGVHDTVVNQLLSKMDGVERLNNILVIGMTNRRDMIDEALLR 349
            FDEIDAI  ARG     T V D +VNQLL++MDG++ L+N++VI  TNR D++D ALLR
Sbjct: 551 FFDEIDAIAPARGARFD-TSVTDRIVNQLLTEMDGIQELSNVVVIAATNRPDILDPALLR 609

Query: 350 PGRLE 354
           PGR +
Sbjct: 610 PGRFD 614

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|214386 CHL00176, ftsH, cell division protein; Validated	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|214386 CHL00176, ftsH, cell division protein; Validated	Back alignment and domain information

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215012 smart01073, CDC48_N, Cell division protein 48 (CDC48) N-terminal domain	Back alignment and domain information

>gnl\|CDD\|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|216993 pfam02359, CDC48_N, Cell division protein 48 (CDC48), N-terminal domain	Back alignment and domain information

>gnl\|CDD\|177094 CHL00195, ycf46, Ycf46; Provisional	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		358
KOG0733\|consensus		802		100.0
KOG0730\|consensus		693		100.0
KOG0736\|consensus		953		100.0
KOG0735\|consensus		952		100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
KOG0741\|consensus		744		100.0
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	100.0
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	100.0
KOG0734\|consensus		752		100.0
KOG0733\|consensus		802		99.97
CHL00195		489	ycf46 Ycf46; Provisional	99.97
KOG0727\|consensus		408		99.97
KOG0729\|consensus		435		99.97
KOG0731\|consensus		774		99.96
KOG0728\|consensus		404		99.96
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.96
KOG0738\|consensus		491		99.96
KOG0741\|consensus		744		99.96
KOG0739\|consensus		439		99.96
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.96
KOG0726\|consensus		440		99.95
KOG0652\|consensus		424		99.95
KOG0651\|consensus		388		99.94
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	99.94
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.93
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.93
CHL00206		2281	ycf2 Ycf2; Provisional	99.92
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.91
KOG0730\|consensus		693		99.91
KOG0732\|consensus		1080		99.9
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.9
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.89
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.88
KOG0738\|consensus		491		99.88
CHL00176		638	ftsH cell division protein; Validated	99.87
KOG0737\|consensus		386		99.87
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.86
KOG0732\|consensus		1080		99.86
KOG0740\|consensus		428		99.85
KOG0734\|consensus		752		99.84
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.83
KOG0736\|consensus		953		99.82
KOG0652\|consensus		424		99.82
KOG0728\|consensus		404		99.81
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	99.81
KOG0737\|consensus		386		99.8
PF00004		132	AAA: ATPase family associated with various cellula	99.8
KOG0743\|consensus		457		99.79
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.79
KOG0731\|consensus		774		99.78
KOG0727\|consensus		408		99.77
KOG0726\|consensus		440		99.77
CHL00195		489	ycf46 Ycf46; Provisional	99.77
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.76
KOG0729\|consensus		435		99.76
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.76
KOG0739\|consensus		439		99.76
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.75
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.74
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.73
CHL00206		2281	ycf2 Ycf2; Provisional	99.72
KOG0735\|consensus		952		99.72
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.71
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.68
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.67
CHL00176		638	ftsH cell division protein; Validated	99.67
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.64
KOG0740\|consensus		428		99.63
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.63
KOG0744\|consensus		423		99.58
KOG0651\|consensus		388		99.56
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.56
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.31
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.29
KOG0742\|consensus		630		99.29
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.26
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.26
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.2
CHL00095		821	clpC Clp protease ATP binding subunit	99.18
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.14
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.13
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.1
CHL00181		287	cbbX CbbX; Provisional	99.09
PRK10865		857	protein disaggregation chaperone; Provisional	99.03
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	98.96
PRK10865		857	protein disaggregation chaperone; Provisional	98.92
CHL00095		821	clpC Clp protease ATP binding subunit	98.86
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	98.84
KOG2004\|consensus		906		98.81
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	98.8
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	98.78
KOG0743\|consensus		457		98.78
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	98.73
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	98.71
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	98.7
KOG0742\|consensus		630		98.69
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	98.61
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	98.55
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	98.45
COG2256		436	MGS1 ATPase related to the helicase subunit of the	98.44
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	98.4
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	98.37
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	98.29
smart00382		148	AAA ATPases associated with a variety of cellular	98.27
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	98.25
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	98.24
COG0714		329	MoxR-like ATPases [General function prediction onl	98.22
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	98.2
PRK13342		413	recombination factor protein RarA; Reviewed	98.09
PRK07940		394	DNA polymerase III subunit delta'; Validated	98.09
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	98.02
PHA02544		316	44 clamp loader, small subunit; Provisional	98.0
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	97.98
PRK00411		394	cdc6 cell division control protein 6; Reviewed	97.98
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	97.95
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	97.94
KOG1051\|consensus		898		97.89
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	97.89
PTZ00112		1164	origin recognition complex 1 protein; Provisional	97.88
KOG2028\|consensus		554		97.86
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	97.86
PRK04195		482	replication factor C large subunit; Provisional	97.83
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	97.83
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	97.81
PHA02244		383	ATPase-like protein	97.78
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	97.78
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	97.78
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	97.73
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	97.71
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	97.71
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	97.67
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	97.66
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	97.65
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	97.65
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	97.65
KOG0745\|consensus		564		97.63
CHL00181		287	cbbX CbbX; Provisional	97.63
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	97.59
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	97.58
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	97.57
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	97.55
PLN03025		319	replication factor C subunit; Provisional	97.55
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	97.54
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	97.54
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	97.51
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	97.51
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	97.47
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	97.45
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	97.43
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	97.43
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	97.43
KOG0744\|consensus		423		97.43
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	97.42
PRK13341		725	recombination factor protein RarA/unknown domain f	97.42
PRK00149		450	dnaA chromosomal replication initiation protein; R	97.41
PRK06893		229	DNA replication initiation factor; Validated	97.41
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	97.4
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	97.37
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	97.35
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	97.34
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	97.34
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	97.29
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	97.26
PF07726		131	AAA_3: ATPase family associated with various cellu	97.25
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	97.23
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	97.23
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	97.22
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	97.22
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	97.17
PRK14088		440	dnaA chromosomal replication initiation protein; P	97.12
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.1
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	97.09
PRK12402		337	replication factor C small subunit 2; Reviewed	97.08
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	97.04
PRK05707		328	DNA polymerase III subunit delta'; Validated	97.02
KOG0989\|consensus		346		97.02
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	97.02
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	97.02
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	96.99
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	96.93
PRK07471		365	DNA polymerase III subunit delta'; Validated	96.9
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	96.9
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	96.9
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	96.89
smart00350		509	MCM minichromosome maintenance proteins.	96.86
PRK13531		498	regulatory ATPase RavA; Provisional	96.85
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	96.8
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	96.8
PRK09112		351	DNA polymerase III subunit delta'; Validated	96.79
KOG1969\|consensus		877		96.76
PRK06964		342	DNA polymerase III subunit delta'; Validated	96.75
PRK00440		319	rfc replication factor C small subunit; Reviewed	96.74
PRK12422		445	chromosomal replication initiation protein; Provis	96.72
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	96.7
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	96.7
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	96.69
PRK05564		313	DNA polymerase III subunit delta'; Validated	96.67
PRK06526		254	transposase; Provisional	96.67
PRK14086		617	dnaA chromosomal replication initiation protein; P	96.61
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	96.59
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	96.57
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	96.54
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	96.49
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	96.49
PRK08084		235	DNA replication initiation factor; Provisional	96.46
PRK08058		329	DNA polymerase III subunit delta'; Validated	96.4
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	96.25
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	96.18
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	96.17
PRK08727		233	hypothetical protein; Validated	96.12
PRK05642		234	DNA replication initiation factor; Validated	96.11
PRK06620		214	hypothetical protein; Validated	96.04
PRK08903		227	DnaA regulatory inactivator Hda; Validated	96.02
KOG0478\|consensus		804		95.98
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	95.97
PRK08181		269	transposase; Validated	95.97
PRK00149		450	dnaA chromosomal replication initiation protein; R	95.96
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	95.96
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	95.95
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	95.94
PRK06893		229	DNA replication initiation factor; Validated	95.92
PRK08116		268	hypothetical protein; Validated	95.91
PRK07952		244	DNA replication protein DnaC; Validated	95.79
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	95.78
PRK09862		506	putative ATP-dependent protease; Provisional	95.67
PRK12377		248	putative replication protein; Provisional	95.67
PRK14087		450	dnaA chromosomal replication initiation protein; P	95.65
KOG1514\|consensus		767		95.59
PRK07993		334	DNA polymerase III subunit delta'; Validated	95.43
PRK04132		846	replication factor C small subunit; Provisional	95.39
PRK09183		259	transposase/IS protein; Provisional	95.37
PRK06871		325	DNA polymerase III subunit delta'; Validated	95.36
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	95.36
cd00983		325	recA RecA is a bacterial enzyme which has roles in	95.31
PRK00411		394	cdc6 cell division control protein 6; Reviewed	95.24
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	95.2
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	95.18
COG1484		254	DnaC DNA replication protein [DNA replication, rec	95.13
PRK06090		319	DNA polymerase III subunit delta'; Validated	95.08
PRK08769		319	DNA polymerase III subunit delta'; Validated	95.04
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	95.01
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	95.01
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	94.96
PRK07399		314	DNA polymerase III subunit delta'; Validated	94.93
PRK05917		290	DNA polymerase III subunit delta'; Validated	94.87
PRK15424		538	propionate catabolism operon regulatory protein Pr	94.82
TIGR01618		220	phage_P_loop phage nucleotide-binding protein. Thi	94.77
PRK11608		326	pspF phage shock protein operon transcriptional ac	94.74
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	94.74
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	94.62
KOG0990\|consensus		360		94.57
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	94.56
TIGR02237		209	recomb_radB DNA repair and recombination protein R	94.52
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	94.48
PRK05022		509	anaerobic nitric oxide reductase transcription reg	94.4
PRK08084		235	DNA replication initiation factor; Provisional	94.35
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	94.35
PRK09087		226	hypothetical protein; Validated	94.35
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	94.32
PRK06620		214	hypothetical protein; Validated	94.31
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	94.27
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	94.24
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	94.24
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	94.24
PRK08699		325	DNA polymerase III subunit delta'; Validated	94.15
PRK06921		266	hypothetical protein; Provisional	94.08
PRK08903		227	DnaA regulatory inactivator Hda; Validated	93.99
PRK10365		441	transcriptional regulatory protein ZraR; Provision	93.99
PF05272		198	VirE: Virulence-associated protein E; InterPro: IP	93.99
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	93.98
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	93.97
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	93.97
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	93.96
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	93.95
PRK08727		233	hypothetical protein; Validated	93.9
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	93.86
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	93.84
PRK08939		306	primosomal protein DnaI; Reviewed	93.73
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	93.7
PF05707		193	Zot: Zonular occludens toxin (Zot); InterPro: IPR0	93.6
PRK12422		445	chromosomal replication initiation protein; Provis	93.57
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	93.56
PRK09354		349	recA recombinase A; Provisional	93.55
PF00493		331	MCM: MCM2/3/5 family This family extends the MCM d	93.55
PRK07940		394	DNA polymerase III subunit delta'; Validated	93.51
PRK14088		440	dnaA chromosomal replication initiation protein; P	93.51
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	93.43
PF05729		166	NACHT: NACHT domain	93.41
cd01394		218	radB RadB. The archaeal protein radB shares simila	93.29
PRK09519		790	recA DNA recombination protein RecA; Reviewed	93.28
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	93.12
PRK07276		290	DNA polymerase III subunit delta'; Validated	93.04
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	93.01
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	92.92
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	92.84
KOG2383\|consensus		467		92.83
PTZ00112		1164	origin recognition complex 1 protein; Provisional	92.83
PRK05642		234	DNA replication initiation factor; Validated	92.73
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	92.65
COG1485		367	Predicted ATPase [General function prediction only	92.49
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	92.47
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	92.41
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	92.41
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	92.24
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	92.0
COG2874		235	FlaH Predicted ATPases involved in biogenesis of a	91.8
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	91.79
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	91.7
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	91.69
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	91.64
PRK14086		617	dnaA chromosomal replication initiation protein; P	91.64
KOG0991\|consensus		333		91.63
PRK15115		444	response regulator GlrR; Provisional	91.57
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	91.57
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	91.44
PRK06835		329	DNA replication protein DnaC; Validated	91.35
PRK09087		226	hypothetical protein; Validated	91.25
COG1221		403	PspF Transcriptional regulators containing an AAA-	91.23
COG2204		464	AtoC Response regulator containing CheY-like recei	91.2
KOG2227\|consensus		529		91.05
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	91.02
PRK12402		337	replication factor C small subunit 2; Reviewed	90.98
KOG1051\|consensus		898		90.96
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	90.91
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	90.89
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	90.85
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	90.8
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	90.76
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	90.46
PRK13342		413	recombination factor protein RarA; Reviewed	90.44
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	90.37
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	90.32
KOG0482\|consensus		721		90.25
smart00350		509	MCM minichromosome maintenance proteins.	90.11
PRK11823		446	DNA repair protein RadA; Provisional	90.06
PRK00440		319	rfc replication factor C small subunit; Reviewed	89.97
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	89.75
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	89.71
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	89.65
COG0593		408	DnaA ATPase involved in DNA replication initiation	89.64
PHA02544		316	44 clamp loader, small subunit; Provisional	89.61
PF13173		128	AAA_14: AAA domain	89.42
PRK14087		450	dnaA chromosomal replication initiation protein; P	89.36
PRK06067		234	flagellar accessory protein FlaH; Validated	89.33
cd01128		249	rho_factor Transcription termination factor rho is	89.26
COG3284		606	AcoR Transcriptional activator of acetoin/glycerol	89.24
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	89.23
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	89.11
PRK04195		482	replication factor C large subunit; Provisional	88.82
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	88.62
PRK08533		230	flagellar accessory protein FlaH; Reviewed	88.51
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	88.46
PRK05818		261	DNA polymerase III subunit delta'; Validated	88.35
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	88.34
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	88.31
COG1241		682	MCM2 Predicted ATPase involved in replication cont	88.3
PHA00729		226	NTP-binding motif containing protein	88.25
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	87.98
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	87.85
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	87.48
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	87.16
KOG1968\|consensus		871		87.1
PRK10536		262	hypothetical protein; Provisional	86.98
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	86.91
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	86.76
PF09336		62	Vps4_C: Vps4 C terminal oligomerisation domain; In	86.68
PRK10867		433	signal recognition particle protein; Provisional	86.49
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	86.44
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	86.4
PF00154		322	RecA: recA bacterial DNA recombination protein; In	86.18
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	86.13
PRK00771		437	signal recognition particle protein Srp54; Provisi	86.04
COG4650		531	RtcR Sigma54-dependent transcription regulator con	85.88
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	85.45
PRK14974		336	cell division protein FtsY; Provisional	85.18
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	84.98
KOG0477\|consensus		854		84.97
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	84.96
KOG2170\|consensus		344		84.91
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	84.87
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	84.75
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	84.75
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	84.35
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	84.3
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	84.17
PRK07132		299	DNA polymerase III subunit delta'; Validated	84.1
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	84.03
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	83.66
KOG1942\|consensus		456		83.61
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	83.58
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	83.38
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	83.16
cd03115		173	SRP The signal recognition particle (SRP) mediates	83.05
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	82.91
PRK04132		846	replication factor C small subunit; Provisional	82.32
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	82.16
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	82.14
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	82.0
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	81.94
COG0593		408	DnaA ATPase involved in DNA replication initiation	81.78
COG3283		511	TyrR Transcriptional regulator of aromatic amino a	81.77
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	81.76
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	81.7
PF01580		205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	81.25
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	81.21
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	80.96
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	80.63
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	80.29
PRK09112		351	DNA polymerase III subunit delta'; Validated	80.28
PRK13341		725	recombination factor protein RarA/unknown domain f	80.21

>KOG0733\|consensus	Back alignment and domain information

Probab=100.00  E-value=6.3e-68  Score=515.65  Aligned_cols=296  Identities=34%  Similarity=0.472  Sum_probs=254.4

Q ss_pred             CCCccCC----CCeEEEEecCCCCCcchhhcCCCCCceEEEecCCCHHHHHHHHHHHHhccccccccCchhhHHHHHHhc
Q psy3629           1 MDGVERL----NNILVIGMTNRRDMIDEALLRPGRLELQMEISLPNEDGRVQILQIHTAKMRSYKKLADDVNLKELAALT   76 (358)
Q Consensus         1 lDg~~~~----~~V~vI~aTN~p~~LD~Al~R~GRfd~~I~v~~P~~~~R~~il~~~l~~~~~~~~~~~~~~l~~la~~t   76 (358)
                      ||++...    .+|+||||||||+.||||++|+||||+.|.+..|+..+|.+||+..++++    .+..++++++||+.|
T Consensus       317 mD~l~~~~~~g~~VlVIgATnRPDslDpaLRRaGRFdrEI~l~vP~e~aR~~IL~~~~~~l----rl~g~~d~~qlA~lT  392 (802)
T KOG0733|consen  317 MDELSNEKTKGDPVLVIGATNRPDSLDPALRRAGRFDREICLGVPSETAREEILRIICRGL----RLSGDFDFKQLAKLT  392 (802)
T ss_pred             hhcccccccCCCCeEEEecCCCCcccCHHHhccccccceeeecCCchHHHHHHHHHHHhhC----CCCCCcCHHHHHhcC
Confidence            6777543    57999999999999999999999999999999999999999999999988    577899999999999


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHhcCc---------c---------c-----------------------------cC
Q psy3629          77 KNFSGAELEGLVRAAQSCAMNRLIKATNK---------V---------E-----------------------------VD  109 (358)
Q Consensus        77 ~g~sgadi~~l~~~A~~~a~~r~~~~~~~---------~---------~-----------------------------~~  109 (358)
                      +||.||||+++|.+|+..|++|+++....         +         .                             .+
T Consensus       393 PGfVGADL~AL~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~~i~~~~d~~S  472 (802)
T KOG0733|consen  393 PGFVGADLMALCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQDAILNNPDPLS  472 (802)
T ss_pred             CCccchhHHHHHHHHHHHHHHHHhhcccCccccCCccccccCCCccchhhhhhcCCcccccccHHHHHHHHHHhCCCCcC
Confidence            99999999999999999999998873320         0         0                             00


Q ss_pred             hhhhhhhccCHHHHHHhhhcCccCCCCCChhhhHHHhhcCcccCCCc--hh----hhhhhhhhh---hhhccccccccce
Q psy3629         110 PQALEKLCITRADFLHALETDIKPAFGSSDESLEHFLSRGILNWGTP--VQ----ECLEAGRIF---IQQSKDTESSGLV  180 (358)
Q Consensus       110 ~~~~~~~~v~~~Df~~al~~~~kps~~~s~~~l~~~~~~~~~~~~d~--v~----~~~~~~~~~---~~~~~~~~~~~~~  180 (358)
                      .+..+...++.+||++|+.. ++|+.     ..++|..+|.++|.|.  .+    ++...+.+.   .+.++..+...+.
T Consensus       473 ~E~~~~L~i~~eDF~~Al~~-iQPSa-----kREGF~tVPdVtW~dIGaL~~vR~eL~~aI~~PiK~pd~~k~lGi~~Ps  546 (802)
T KOG0733|consen  473 KELLEGLSIKFEDFEEALSK-IQPSA-----KREGFATVPDVTWDDIGALEEVRLELNMAILAPIKRPDLFKALGIDAPS  546 (802)
T ss_pred             hHHhccceecHHHHHHHHHh-cCcch-----hcccceecCCCChhhcccHHHHHHHHHHHHhhhccCHHHHHHhCCCCCC
Confidence            12334567899999999999 99996     5678889999999992  11    122222222   2456777888899


Q ss_pred             eeeeeccCCCCc-hhhhhhHHhhhcccccccccccccccCCCCccccccccCcccccccccccHHHHHHHhhhccccccc
Q psy3629         181 SVLLEVDKVPTD-ELSLSNFAAANKDDFVEDTKHIEVTTGPGRHYIFTLAYSPDVKRGFIGFSLLQRKWAELSLHQDIDV  259 (358)
Q Consensus       181 ~~ll~gp~~pg~-kt~l~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~s~~~~~~~~~~~~~~~~~  259 (358)
                      |+||+||  ||| ||.+   |+++               |++.+.+|+.+.+|+++++|+|+||.+              
T Consensus       547 GvLL~GP--PGCGKTLl---AKAV---------------ANEag~NFisVKGPELlNkYVGESErA--------------  592 (802)
T KOG0733|consen  547 GVLLCGP--PGCGKTLL---AKAV---------------ANEAGANFISVKGPELLNKYVGESERA--------------  592 (802)
T ss_pred             ceEEeCC--CCccHHHH---HHHH---------------hhhccCceEeecCHHHHHHHhhhHHHH--------------
Confidence            9999999  999 9999   9999               999999999999999988888776665              


Q ss_pred             cccccCCCCchhHHHHHHhhcCCCCCceEEEEccchhhhhhcCCCCCCcchhhHHHHHHHHccCCCCCCCCEEEEEecCC
Q psy3629         260 KPFFFNPKNTSEFLCTIILEAGPNSGLHIIIFDEIDAICKARGTAGGNTGVHDTVVNQLLSKMDGVERLNNILVIGMTNR  339 (358)
Q Consensus       260 ~~~~~~~~~~~e~~~~~~f~~a~~~~p~iif~DeiD~~~~~r~~~~~~~~~~~~~~~~lL~~ld~~~~~~~v~vi~aTn~  339 (358)
                                    ||+||++||+++||||||||+|+|++.|+..+..  ++.||+||||+||||++.+.+|+|||||||
T Consensus       593 --------------VR~vFqRAR~saPCVIFFDEiDaL~p~R~~~~s~--~s~RvvNqLLtElDGl~~R~gV~viaATNR  656 (802)
T KOG0733|consen  593 --------------VRQVFQRARASAPCVIFFDEIDALVPRRSDEGSS--VSSRVVNQLLTELDGLEERRGVYVIAATNR  656 (802)
T ss_pred             --------------HHHHHHHhhcCCCeEEEecchhhcCcccCCCCch--hHHHHHHHHHHHhcccccccceEEEeecCC
Confidence                          5555999999999999999999999999876644  889999999999999999999999999999


Q ss_pred             ccccchhcCCCCCCccc
Q psy3629         340 RDMIDEALLRPGRLEVS  356 (358)
Q Consensus       340 ~~~iD~a~lr~GRfd~~  356 (358)
                      ||.||||+|||||||..
T Consensus       657 PDiIDpAiLRPGRlDk~  673 (802)
T KOG0733|consen  657 PDIIDPAILRPGRLDKL  673 (802)
T ss_pred             CcccchhhcCCCccCce
Confidence            99999999999999974

>KOG0730\|consensus	Back alignment and domain information

>KOG0736\|consensus	Back alignment and domain information

>KOG0735\|consensus	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0741\|consensus	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0734\|consensus	Back alignment and domain information

>KOG0733\|consensus	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>KOG0727\|consensus	Back alignment and domain information

>KOG0729\|consensus	Back alignment and domain information

>KOG0731\|consensus	Back alignment and domain information

>KOG0728\|consensus	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0738\|consensus	Back alignment and domain information

>KOG0741\|consensus	Back alignment and domain information

>KOG0739\|consensus	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>KOG0726\|consensus	Back alignment and domain information

>KOG0652\|consensus	Back alignment and domain information

>KOG0651\|consensus	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>KOG0730\|consensus	Back alignment and domain information

>KOG0732\|consensus	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>KOG0738\|consensus	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>KOG0737\|consensus	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>KOG0732\|consensus	Back alignment and domain information

>KOG0740\|consensus	Back alignment and domain information

>KOG0734\|consensus	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>KOG0736\|consensus	Back alignment and domain information

>KOG0652\|consensus	Back alignment and domain information

>KOG0728\|consensus	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0737\|consensus	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>KOG0743\|consensus	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>KOG0731\|consensus	Back alignment and domain information

>KOG0727\|consensus	Back alignment and domain information

>KOG0726\|consensus	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG0729\|consensus	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0739\|consensus	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>KOG0735\|consensus	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>KOG0740\|consensus	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>KOG0744\|consensus	Back alignment and domain information

>KOG0651\|consensus	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>KOG0742\|consensus	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>KOG2004\|consensus	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>KOG0743\|consensus	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>KOG0742\|consensus	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>KOG1051\|consensus	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>KOG2028\|consensus	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0745\|consensus	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0744\|consensus	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0989\|consensus	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1969\|consensus	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>KOG0478\|consensus	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG1514\|consensus	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>TIGR01618 phage_P_loop phage nucleotide-binding protein	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>KOG0990\|consensus	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot)	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG2383\|consensus	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>COG1485 Predicted ATPase [General function prediction only]	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG0991\|consensus	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG2227\|consensus	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>KOG1051\|consensus	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>KOG0482\|consensus	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription]	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>KOG1968\|consensus	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response []	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0477\|consensus	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>KOG2170\|consensus	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1942\|consensus	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

Homologous Structure Templates