Diaphorina citri psyllid: psy3631

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----

MGEQQYCRFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYENSK

ccccHHHHHHHHcccccHHHHHHccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHcc

*GEQQ**RFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYE***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGEQQYCRFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYENSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Annexin-B9		confident	P22464

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9I, chain A
Confidence level:very confident
Coverage over the Query: 2-183
View the alignment between query and template
View the model in PyMOL