Psyllid ID: psy3631

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MGEQQYCRFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYENSK
cccHHHHHHHHHHcccHHHHHHHccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHcc
ccccccccccccccHHccccHHHccEcccccccccHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHcccccHHHcHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHHcc
mgeqqycrfdsslgstyrclfqqclptvvpadpfdpngdAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLfgkeesfdpavtTKLLYHNVIRHLFQcsihclphqdLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDamsgvgtdEEAIVEILSTLSNYGIRTIAEVYENSK
MGEQQYCRFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILStlsnygirtiaevyensk
MGEQQYCRFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYENSK
*****YCRFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLA*********IADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVY****
*GEQQ**RFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYE***
MGEQQYCRFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYENSK
**********SSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYENSK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEQQYCRFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYENSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
P22464 324 Annexin-B9 OS=Drosophila yes N/A 0.701 0.398 0.583 3e-46
Q9VXG4 322 Annexin-B11 OS=Drosophila no N/A 0.668 0.381 0.470 2e-31
P22465 320 Annexin-B10 OS=Drosophila no N/A 0.679 0.390 0.477 8e-31
Q5VT79 327 Annexin A8-like protein 2 yes N/A 0.722 0.406 0.436 2e-28
P13928 327 Annexin A8 OS=Homo sapien yes N/A 0.722 0.406 0.436 3e-28
Q5T2P8 327 Annexin A8-like protein 1 yes N/A 0.722 0.406 0.436 3e-28
P20072 463 Annexin A7 OS=Bos taurus yes N/A 0.673 0.267 0.461 8e-28
Q07076 463 Annexin A7 OS=Mus musculu yes N/A 0.668 0.265 0.445 1e-27
A5A6L7 327 Annexin A8 OS=Pan troglod yes N/A 0.722 0.406 0.430 1e-27
O35640 327 Annexin A8 OS=Mus musculu no N/A 0.722 0.406 0.430 2e-27
>sp|P22464|ANXB9_DROME Annexin-B9 OS=Drosophila melanogaster GN=AnnIX PE=2 SV=2 Back     alignment and function desciption
 Score =  184 bits (466), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 111/161 (68%), Gaps = 32/161 (19%)

Query: 23  QCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGK 82
           +C PTV PADPFDP  DA +LR AMKGFGTDE++II++LA+R   QR EIA+AFKT +GK
Sbjct: 10  KCTPTVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGK 69

Query: 83  EESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPEL 142
                                           DLI DLKSELGG FED I+ALMTPLP+ 
Sbjct: 70  --------------------------------DLISDLKSELGGKFEDVILALMTPLPQF 97

Query: 143 YAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYENS 183
           YA+ELHDA+SG+GTDEEAI+EIL TLSNYGI+TIA+ YE S
Sbjct: 98  YAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQS 138

Drosophila melanogaster (taxid: 7227)
>sp|Q9VXG4|ANX11_DROME Annexin-B11 OS=Drosophila melanogaster GN=Anxb11 PE=2 SV=1 Back     alignment and function description
>sp|P22465|ANX10_DROME Annexin-B10 OS=Drosophila melanogaster GN=AnnX PE=2 SV=2 Back     alignment and function description
>sp|Q5VT79|AXA82_HUMAN Annexin A8-like protein 2 OS=Homo sapiens GN=ANXA8L2 PE=2 SV=1 Back     alignment and function description
>sp|P13928|ANXA8_HUMAN Annexin A8 OS=Homo sapiens GN=ANXA8 PE=1 SV=3 Back     alignment and function description
>sp|Q5T2P8|AXA81_HUMAN Annexin A8-like protein 1 OS=Homo sapiens GN=ANXA8L1 PE=2 SV=1 Back     alignment and function description
>sp|P20072|ANXA7_BOVIN Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2 Back     alignment and function description
>sp|Q07076|ANXA7_MOUSE Annexin A7 OS=Mus musculus GN=Anxa7 PE=2 SV=2 Back     alignment and function description
>sp|A5A6L7|ANXA8_PANTR Annexin A8 OS=Pan troglodytes GN=ANXA8 PE=2 SV=1 Back     alignment and function description
>sp|O35640|ANXA8_MOUSE Annexin A8 OS=Mus musculus GN=Anxa8 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
347970647 325 AGAP003790-PD [Anopheles gambiae str. PE 0.690 0.390 0.622 3e-46
312371954 362 hypothetical protein AND_20798 [Anophele 0.717 0.364 0.603 3e-46
347970642 324 AGAP003790-PC [Anopheles gambiae str. PE 0.690 0.391 0.622 4e-46
158288476 324 AGAP003790-PA [Anopheles gambiae str. PE 0.690 0.391 0.622 4e-46
347970644 324 AGAP003790-PB [Anopheles gambiae str. PE 0.690 0.391 0.622 4e-46
332030546 324 Annexin-B9 [Acromyrmex echinatior] 0.744 0.422 0.549 1e-45
307181035 324 Annexin-B9 [Camponotus floridanus] 0.744 0.422 0.565 1e-45
157129006 325 annexin [Aedes aegypti] gi|108872401|gb| 0.695 0.393 0.606 1e-45
322783201 324 hypothetical protein SINV_01089 [Solenop 0.744 0.422 0.554 2e-45
157129010 324 annexin [Aedes aegypti] gi|94468944|gb|A 0.695 0.395 0.606 2e-45
>gi|347970647|ref|XP_003436620.1| AGAP003790-PD [Anopheles gambiae str. PEST] gi|333466768|gb|EGK96374.1| AGAP003790-PD [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 108/159 (67%), Gaps = 32/159 (20%)

Query: 23  QCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGK 82
           QC PTV PADPFD N DA  LR AMKGFGTDE++II+VLA+R   QR EIA AFKT FGK
Sbjct: 10  QCTPTVYPADPFDANEDAGTLRTAMKGFGTDEKAIIEVLARRGIVQRLEIAQAFKTSFGK 69

Query: 83  EESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPEL 142
                                           DLI DLKSELGG FED I+ALMTPLP+ 
Sbjct: 70  --------------------------------DLISDLKSELGGKFEDVILALMTPLPQF 97

Query: 143 YAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYE 181
           YAKELHDA+SG+GTDEEAI+EIL TLSNYGIRTIAE YE
Sbjct: 98  YAKELHDAISGIGTDEEAIIEILCTLSNYGIRTIAEFYE 136

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312371954|gb|EFR20012.1| hypothetical protein AND_20798 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347970642|ref|XP_003436618.1| AGAP003790-PC [Anopheles gambiae str. PEST] gi|333466767|gb|EGK96373.1| AGAP003790-PC [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158288476|ref|XP_559572.2| AGAP003790-PA [Anopheles gambiae str. PEST] gi|157019100|gb|EAL41340.2| AGAP003790-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|347970644|ref|XP_003436619.1| AGAP003790-PB [Anopheles gambiae str. PEST] gi|333466766|gb|EGK96372.1| AGAP003790-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|332030546|gb|EGI70234.1| Annexin-B9 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307181035|gb|EFN68809.1| Annexin-B9 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157129006|ref|XP_001655242.1| annexin [Aedes aegypti] gi|108872401|gb|EAT36626.1| AAEL011302-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|322783201|gb|EFZ10787.1| hypothetical protein SINV_01089 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|157129010|ref|XP_001655244.1| annexin [Aedes aegypti] gi|94468944|gb|ABF18321.1| annexin [Aedes aegypti] gi|108872403|gb|EAT36628.1| AAEL011302-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
FB|FBgn0030749 322 AnxB11 "Annexin B11" [Drosophi 0.364 0.208 0.552 2.4e-32
UNIPROTKB|B4DTC9141 ANXA8 "Annexin" [Homo sapiens 0.309 0.404 0.614 5.9e-29
UNIPROTKB|E7EVD9141 ANXA8L2 "Annexin" [Homo sapien 0.309 0.404 0.614 5.9e-29
UNIPROTKB|F5H7X5141 ANXA8L1 "Annexin" [Homo sapien 0.309 0.404 0.614 5.9e-29
UNIPROTKB|B4DT77 336 ANXA7 "Annexin" [Homo sapiens 0.309 0.169 0.649 2.2e-28
UNIPROTKB|P20072 463 ANXA7 "Annexin A7" [Bos taurus 0.309 0.123 0.684 3e-28
MGI|MGI:88031 463 Anxa7 "annexin A7" [Mus muscul 0.309 0.123 0.631 3.7e-28
UNIPROTKB|E2QXN8 505 ANXA11 "Annexin" [Canis lupus 0.309 0.112 0.649 3.8e-28
UNIPROTKB|F1SU59 463 ANXA7 "Annexin" [Sus scrofa (t 0.309 0.123 0.666 3.9e-28
UNIPROTKB|I3LEY2 468 ANXA7 "Annexin" [Sus scrofa (t 0.309 0.121 0.666 4.1e-28
FB|FBgn0030749 AnxB11 "Annexin B11" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 194 (73.4 bits), Expect = 2.4e-32, Sum P(2) = 2.4e-32
 Identities = 37/67 (55%), Positives = 49/67 (73%)

Query:   114 QDLIDDLKSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGI 173
             +DLI+D+KSE  GNFE  +V L+ P+ + Y  EL+DAM+G+GTDEE ++EIL TLSN  I
Sbjct:    63 KDLIEDIKSETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEI 122

Query:   174 RTIAEVY 180
              TI   Y
Sbjct:   123 NTIKNQY 129
GO:0005544 "calcium-dependent phospholipid binding" evidence=IEA;NAS
GO:0003779 "actin binding" evidence=ISS
GO:0005575 "cellular_component" evidence=ND
GO:0007155 "cell adhesion" evidence=IMP
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0005509 "calcium ion binding" evidence=IEA
UNIPROTKB|B4DTC9 ANXA8 "Annexin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EVD9 ANXA8L2 "Annexin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H7X5 ANXA8L1 "Annexin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DT77 ANXA7 "Annexin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P20072 ANXA7 "Annexin A7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:88031 Anxa7 "annexin A7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXN8 ANXA11 "Annexin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SU59 ANXA7 "Annexin" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEY2 ANXA7 "Annexin" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P22464ANXB9_DROMENo assigned EC number0.58380.70100.3981yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
pfam0019166 pfam00191, Annexin, Annexin 3e-23
smart0033553 smart00335, ANX, Annexin repeats 9e-18
pfam0019166 pfam00191, Annexin, Annexin 7e-10
smart0033553 smart00335, ANX, Annexin repeats 3e-04
>gnl|CDD|201070 pfam00191, Annexin, Annexin Back     alignment and domain information 
 Score = 87.1 bits (217), Expect = 3e-23
 Identities = 39/97 (40%), Positives = 50/97 (51%), Gaps = 32/97 (32%)

Query: 39  DAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHN 98
           DAE+LRAAMKG GTDE ++I +LA RSN Q Q I +A+K L+GK                
Sbjct: 2   DAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKLYGK---------------- 45

Query: 99  VIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVAL 135
                           DL  D+KSE  G+FE  ++AL
Sbjct: 46  ----------------DLEKDIKSETSGDFEKLLLAL 66

This family of annexins also includes giardin that has been shown to function as an annexin. Length = 66
>gnl|CDD|197661 smart00335, ANX, Annexin repeats Back     alignment and domain information
>gnl|CDD|201070 pfam00191, Annexin, Annexin Back     alignment and domain information
>gnl|CDD|197661 smart00335, ANX, Annexin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
KOG0819|consensus321 100.0
KOG0819|consensus 321 100.0
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 99.78
smart0033553 ANX Annexin repeats. 99.51
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 98.92
smart0033553 ANX Annexin repeats. 97.78
>KOG0819|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.7e-46  Score=315.53  Aligned_cols=173  Identities=28%  Similarity=0.526  Sum_probs=153.4

Q ss_pred             cchHHhHHHhhhcchh-HhhhhccCccccCCCCCChHHHHHHHHHHHhcCCCCHHHHHHHHhcCCHHHHHHHHHHhhhhh
Q psy3631           2 GEQQYCRFDSSLGSTY-RCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLF   80 (184)
Q Consensus         2 ~~~~~~~~~~~~g~~~-~~~~~~~~~~i~~~~~~~~~~DA~~l~~A~kg~Gtde~~LieIL~~Rs~~ql~~Ik~~Y~~~y   80 (184)
                      |+||+++|||||||+| +.+++    .+.||.    ++||++|++||||.||||.+||||||||||.|+++|+++|+..|
T Consensus        63 gkDLi~~Lk~ELsG~Fe~~i~a----l~~~p~----~~DA~~l~~amkg~gtde~vlIEIlcTRT~~el~~i~~aY~~~y  134 (321)
T KOG0819|consen   63 GKDLIKDLKSELSGDFERAIVA----LMKPPA----EYDAKELKKAMKGLGTDEKVLIEILCTRTNEELRAIRQAYQELY  134 (321)
T ss_pred             hHHHHHHHHHHhCccHHHHHHH----HcCCHH----HhHHHHHHHHHhccCcchhhheeeeccCCHHHHHHHHHHHHHHH
Confidence            8999999999997666 77775    455553    55999999999999999999999999999999999999999999


Q ss_pred             CCCCCCChhhhHHHHHHH-----------------------------------------------------HHHHHHHhh
Q psy3631          81 GKEESFDPAVTTKLLYHN-----------------------------------------------------VIRHLFQCS  107 (184)
Q Consensus        81 ~k~l~~d~~~~~~~l~~~-----------------------------------------------------~~~~~~~~~  107 (184)
                      +++||+|+.+||++-|.+                                                     +++++|+ .
T Consensus       135 ~~sLEeDI~s~TSG~frklLv~L~~~~R~e~~~vd~~la~~dA~~L~~Age~k~gtde~~~~~Il~tRs~~qL~~vf~-~  213 (321)
T KOG0819|consen  135 KKSLEEDIASDTSGDFRKLLVSLVQGNRDEGDRVDDALAKQDAQDLYEAGEKKWGTDEDKFIRILTTRSKAQLRLVFE-E  213 (321)
T ss_pred             cccHHHHhhhccCchHHHHHHHHHhcCCccCCCcCHHHHHHHHHHHHHHhhhhccCcHHHHHHHHHhCCHHHHHHHHH-H
Confidence            999999999976544433                                                     1233444 4


Q ss_pred             hhcCCcCchHHHHhhhhcchHHHHHHHHh---CCChHHHHHHHHHhhcCCCCCHHHHHHHHHhCCHHHHHHHHHHHhcC
Q psy3631         108 IHCLPHQDLIDDLKSELGGNFEDAIVALM---TPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYENS  183 (184)
Q Consensus       108 ~~~~~~~~L~~~I~~e~sG~~~~~l~~l~---~~~~~~~A~~l~~Am~g~gtd~~~LirIlvsRse~dL~~Ik~~Y~~~  183 (184)
                      |+..+|++|+++|+++++|+++.+|++++   +|||.|||+.||+||+|.|||+.+||||+|||||+||..|+.+|++.
T Consensus       214 y~~~~g~diek~I~~e~~gd~~~~llaiv~c~~n~~~yFA~~L~~amkg~GTdd~~LiRI~VsRsEiDl~~Ik~ef~~~  292 (321)
T KOG0819|consen  214 YQRISGKDIEKSIKEEFSGDFEKLLLAIVKCIRNPPAYFAERLRKAMKGLGTDDKTLIRIVVSRSEIDLLDIKEEFQRK  292 (321)
T ss_pred             HHHhcchhHHHHHhhccCchHHHHHHHHHHHHcCHHHHHHHHHHHHHhccCCCccceeeeeeeHHHhhHHHHHHHHHHH
Confidence            77889999999999999999999999875   99999999999999999999999999999999999999999999874

>KOG0819|consensus Back     alignment and domain information
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
1w45_A 327 The 2.5 Angstroem Structure Of The K16a Mutant Of A 1e-29
1w3w_A 327 The 2.1 Angstroem Resolution Structure Of Annexin A 2e-29
1m9i_A 672 Crystal Structure Of Phosphorylation-Mimicking Muta 8e-27
1avh_A 320 Crystal And Molecular Structure Of Human Annexin V 2e-26
1anw_A 319 The Effect Of Metal Binding On The Structure Of Ann 2e-26
1avc_A 673 Bovine Annexin Vi (Calcium-Bound) Length = 673 2e-26
1hvd_A 319 Structural And Electrophysiological Analysis Of Ann 2e-26
1ala_A 321 Structure Of Chicken Annexin V At 2.25-Angstroms Re 2e-26
1yii_A 320 Crystal Structures Of Chicken Annexin V In Complex 2e-26
1bcw_A 319 Recombinant Rat Annexin V, T72a Mutant Length = 319 3e-26
1sav_A 320 Human Annexin V With Proline Substitution By Thiopr 3e-26
1bcz_A 319 Recombinant Rat Annexin V, T72s Mutant Length = 319 3e-26
2ran_A 316 Rat Annexin V Crystal Structure: Ca2+-Induced Confo 4e-26
1bcy_A 319 Recombinant Rat Annexin V, T72k Mutant Length = 319 4e-26
1bc1_A 319 Recombinant Rat Annexin V, Quadruple Mutant (T72k, 4e-26
1bc3_A 319 Recombinant Rat Annexin V, Triple Mutant (T72k, S14 4e-26
1hve_A 319 Structural And Electrophysiological Analysis Of Ann 4e-26
2h0m_A 318 Structure Of A Mutant Of Rat Annexin A5 Length = 31 4e-26
1g5n_A 318 Annexin V Complex With Heparin Oligosaccharides Len 5e-26
1a8a_A 319 Rat Annexin V Complexed With Glycerophosphoserine L 5e-26
1bc0_A 319 Recombinant Rat Annexin V, W185a Mutant Length = 31 5e-26
1n42_A 319 Crystal Structure Of Annexin V R149e Mutant Length 5e-26
1hvf_A 319 Structural And Electrophysiological Analysis Of Ann 5e-26
1n41_A 319 Crystal Structure Of Annexin V K27e Mutant Length = 2e-25
1n44_A 319 Crystal Structure Of Annexin V R23e Mutant Length = 3e-25
1ann_A 318 Annexin Iv Length = 318 4e-25
2zoc_A 319 Crystal Structure Of Recombinant Human Annexin Iv L 4e-25
1aei_A 315 Crystal Structure Of The Annexin Xii Hexamer Length 5e-25
2h0l_A 318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 7e-25
2xo2_A 320 Human Annexin V With Incorporated Methionine Analog 9e-25
1dm5_A 315 Annexin Xii E105k Homohexamer Crystal Structure Len 1e-24
1i4a_A 318 Crystal Structure Of Phosphorylation-Mimicking Muta 1e-24
2h0k_A 318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 4e-24
1aow_A 309 Annexin Iv Length = 309 7e-24
2zhi_A 322 Crystal Structure Analysis Of The Sodium-Bound Anne 4e-23
1axn_A 323 The High Resolution Structure Of Annexin Iii Shows 4e-20
1aii_A 323 Annexin Iii Length = 323 4e-20
1ain_A 314 Crystal Structure Of Human Annexin I At 2.5 Angstro 1e-15
1hm6_A 346 X-Ray Structure Of Full-Length Annexin 1 Length = 3 7e-15
1w7b_A 339 Annexin A2: Does It Induce Membrane Aggregation By 4e-13
1xjl_A 319 Structure Of Human Annexin A2 In The Presence Of Ca 5e-13
2hyu_A 308 Human Annexin A2 With Heparin Tetrasaccharide Bound 1e-12
1ycn_A 317 X-Ray Structure Of Annexin From Arabidopsis Thalian 3e-07
1bo9_A73 Nmr Solution Structure Of Domain 1 Of Human Annexin 2e-06
1n00_A 321 Annexin Gh1 From Cotton Length = 321 7e-06
3brx_A 317 Crystal Structure Of Calcium-Bound Cotton Annexin G 7e-06
1dk5_A 322 Crystal Structure Of Annexin 24(Ca32) From Capsicum 2e-05
3chj_A 337 Crystal Structure Of Alpha-14 Giardin Length = 337 3e-05
>pdb|1W45|A Chain A, The 2.5 Angstroem Structure Of The K16a Mutant Of Annexin A8, Which Has An Intact N-Terminus. Length = 327 Back     alignment and structure 
Iteration: 1

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 90/165 (54%), Gaps = 32/165 (19%)
Query: 17  YRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAF 76
           ++   +Q   TV  +  F+P+ DAE L  AMKG GT+EQ+IIDVL KRSN QRQ+IA +F
Sbjct: 4   WKAWIEQEGVTVASSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSF 63
Query: 77  KTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALM 136
           K  FGK                                DL + LKSEL G FE  IVALM
Sbjct: 64  KAQFGK--------------------------------DLTETLKSELSGKFERLIVALM 91
Query: 137 TPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYE 181
            P     AKELHDAM G+GT E  I+EIL++ +   +R I + YE
Sbjct: 92  YPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYE 136
>pdb|1W3W|A Chain A, The 2.1 Angstroem Resolution Structure Of Annexin A8 Length = 327 Back     alignment and structure
>pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 Back     alignment and structure
>pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 Back     alignment and structure
>pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 Back     alignment and structure
>pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 Back     alignment and structure
>pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1ALA|A Chain A, Structure Of Chicken Annexin V At 2.25-Angstroms Resolution Length = 321 Back     alignment and structure
>pdb|1YII|A Chain A, Crystal Structures Of Chicken Annexin V In Complex With Ca2+ Length = 320 Back     alignment and structure
>pdb|1BCW|A Chain A, Recombinant Rat Annexin V, T72a Mutant Length = 319 Back     alignment and structure
>pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 Back     alignment and structure
>pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 Back     alignment and structure
>pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 Back     alignment and structure
>pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 Back     alignment and structure
>pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 Back     alignment and structure
>pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 Back     alignment and structure
>pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 Back     alignment and structure
>pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 Back     alignment and structure
>pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 Back     alignment and structure
>pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 Back     alignment and structure
>pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 Back     alignment and structure
>pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 Back     alignment and structure
>pdb|1ANN|A Chain A, Annexin Iv Length = 318 Back     alignment and structure
>pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 Back     alignment and structure
>pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 Back     alignment and structure
>pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 Back     alignment and structure
>pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 Back     alignment and structure
>pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 Back     alignment and structure
>pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1AOW|A Chain A, Annexin Iv Length = 309 Back     alignment and structure
>pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 Back     alignment and structure
>pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 Back     alignment and structure
>pdb|1AII|A Chain A, Annexin Iii Length = 323 Back     alignment and structure
>pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 Back     alignment and structure
>pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 Back     alignment and structure
>pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 Back     alignment and structure
>pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 Back     alignment and structure
>pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 Back     alignment and structure
>pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 Back     alignment and structure
>pdb|1BO9|A Chain A, Nmr Solution Structure Of Domain 1 Of Human Annexin I Length = 73 Back     alignment and structure
>pdb|1N00|A Chain A, Annexin Gh1 From Cotton Length = 321 Back     alignment and structure
>pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1 Length = 317 Back     alignment and structure
>pdb|1DK5|A Chain A, Crystal Structure Of Annexin 24(Ca32) From Capsicum Annuum Length = 322 Back     alignment and structure
>pdb|3CHJ|A Chain A, Crystal Structure Of Alpha-14 Giardin Length = 337 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 1e-47
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 7e-18
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 1e-13
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 2e-08
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 9e-08
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 1e-47
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 4e-18
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 1e-15
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 3e-10
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 3e-47
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 1e-17
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 1e-15
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 2e-09
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 5e-08
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 9e-47
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 7e-17
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 9e-15
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 3e-09
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 1e-07
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 9e-46
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 1e-18
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 3e-14
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 1e-10
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 3e-07
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 3e-45
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 4e-19
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 2e-15
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 8e-09
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 3e-07
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 4e-44
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 1e-41
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 2e-19
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 5e-19
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 3e-18
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 1e-15
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 4e-14
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 8e-09
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 5e-08
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 7e-43
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 2e-17
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 2e-16
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 2e-13
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 2e-09
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 6e-42
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 3e-19
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 5e-15
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 1e-08
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 4e-08
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 2e-38
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 2e-16
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 2e-12
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 8e-09
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 8e-38
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 2e-18
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 2e-16
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 9e-06
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 3e-35
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 4e-18
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 5e-14
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 2e-05
3aek_A437 Light-independent protochlorophyllide reductase S; 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
 Score =  157 bits (397), Expect = 1e-47
 Identities = 62/156 (39%), Positives = 81/156 (51%), Gaps = 32/156 (20%)

Query: 26  PTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLFGKEES 85
            TV  A  F+   DA+VLR AMKG GTDE +II VLA R+  QRQEI  A+K+  G    
Sbjct: 9   GTVKAASGFNATEDAQVLRKAMKGLGTDEDAIIGVLACRNTAQRQEIRTAYKSTIG---- 64

Query: 86  FDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALMTPLPELYAK 145
                                       +DL++DLKSEL  NFE  I+ +MTP      +
Sbjct: 65  ----------------------------RDLLEDLKSELSSNFEQVILGMMTPTVLYDVQ 96

Query: 146 ELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYE 181
           EL  AM G GTDE  ++EIL++ +   IR I + Y+
Sbjct: 97  ELRRAMKGAGTDEGCLIEILASRNPEEIRRINQTYQ 132
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>3aek_A Light-independent protochlorophyllide reductase S; iron/sulfur cluster, oxidoreductase, bacteriochlorophyll biosynthesis; HET: PMR; 2.30A {Rhodobacter capsulatus} PDB: 3aeq_A* 3aes_A* 3aer_A* 3aet_A 3aeu_A Length = 437 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 100.0
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 100.0
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 100.0
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 100.0
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 100.0
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 100.0
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 100.0
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 100.0
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 100.0
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 100.0
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 100.0
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 100.0
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 100.0
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 100.0
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 100.0
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 100.0
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 100.0
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 100.0
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 100.0
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 100.0
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 99.98
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 99.96
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 99.96
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 99.95
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
Probab=100.00  E-value=1.4e-39  Score=278.64  Aligned_cols=172  Identities=27%  Similarity=0.503  Sum_probs=149.8

Q ss_pred             cchHHhHHHhhhcchh-HhhhhccCccccCCCCCChHHHHHHHHHHHhcCCCCHHHHHHHHhcCCHHHHHHHHHHhhhhh
Q psy3631           2 GEQQYCRFDSSLGSTY-RCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLF   80 (184)
Q Consensus         2 ~~~~~~~~~~~~g~~~-~~~~~~~~~~i~~~~~~~~~~DA~~l~~A~kg~Gtde~~LieIL~~Rs~~ql~~Ik~~Y~~~y   80 (184)
                      |++|.++|+||++|.| +.++..+.+        .|+.||..|++||+|+||||.+|+||||+|||+|+++|+++|+..|
T Consensus        64 g~~L~~~lkselsG~fe~~l~~l~~~--------~~~~DA~~L~~A~kg~Gtde~~lieIL~~Rs~~ql~~I~~aY~~~y  135 (322)
T 2zhj_A           64 GRDLLEDLKSELSSNFEQVILGMMTP--------TVLYDVQELRRAMKGAGTDEGCLIEILASRNPEEIRRINQTYQQQY  135 (322)
T ss_dssp             CSCHHHHHHHHCCHHHHHHHHHHHSC--------HHHHHHHHHHHHHSSSCCCHHHHHHHHHHSCHHHHHHHHHHHHHHH
T ss_pred             CchHHHHHHhhcCccHHHHHHHHcCC--------cHHHHHHHHHHhhhccCCCHHHHHHHHhcCCHHHHHHHHHHHHHHh
Confidence            8999999999997666 776664443        2588999999999999999999999999999999999999999999


Q ss_pred             CCCCCCChhhhHH-------------------------------HHHHHH----------------------HHHHHHhh
Q psy3631          81 GKEESFDPAVTTK-------------------------------LLYHNV----------------------IRHLFQCS  107 (184)
Q Consensus        81 ~k~l~~d~~~~~~-------------------------------~l~~~~----------------------~~~~~~~~  107 (184)
                      |++|++|+.++++                               .|+.+.                      ++.+++ .
T Consensus       136 ~~~Le~di~~e~sG~~~~~l~~ll~~~r~e~~~vd~~~a~~dA~~L~~A~~~~~Gtde~~li~Il~~Rs~~~L~~i~~-~  214 (322)
T 2zhj_A          136 GRSLEEDICSDTSFMFQRVLVSLTAGGRDEGNYLDDALVKQDAQDLYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFD-E  214 (322)
T ss_dssp             SSCHHHHHHHHCCHHHHHHHHHHHHCCCCCSCCCCHHHHHHHHHHHHHHTTTSSSCCHHHHHHHHHHSCHHHHHHHHH-H
T ss_pred             CccHHHHHHhhcCchHHHHHHHHHhhccccccccCCCHHHHHHHHHHHhhhcCCCCchHHHhHhHHhCCHHHHHHHHH-H
Confidence            9999988877543                               233220                      112222 5


Q ss_pred             hhcCCcCchHHHHhhhhcchHHHHHHHHh---CCChHHHHHHHHHhhcCCCCCHHHHHHHHHhCCHHHHHHHHHHHhc
Q psy3631         108 IHCLPHQDLIDDLKSELGGNFEDAIVALM---TPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVYEN  182 (184)
Q Consensus       108 ~~~~~~~~L~~~I~~e~sG~~~~~l~~l~---~~~~~~~A~~l~~Am~g~gtd~~~LirIlvsRse~dL~~Ik~~Y~~  182 (184)
                      |+..+|++|+++|++++||+++++|++++   ++|+.|||+.||+||+|.|||+++||||+++||+.||..|+.+|++
T Consensus       215 Y~~~~g~~Le~~I~~e~sGd~~~~Llalv~~~~~~~~~~A~~L~~a~~g~Gtde~~lirilv~Rs~~dl~~i~~~Y~~  292 (322)
T 2zhj_A          215 YKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKPAYFAERLYKSMKGLGTDDSTLIRVMVSRAEIDMLDIRANFKR  292 (322)
T ss_dssp             HHHHHSSCHHHHHHHHCCHHHHHHHHHHHHHHHCHHHHHHHHHHHHHSSSSCCHHHHHHHHHHHTTTTHHHHHHHHHH
T ss_pred             HHHHHCcCHHHHHHHhcCccHHHHHHHHHHHhcCccHHHHHHHHHHhccCCCCHHHHHHHHHHcCHHHHHHHHHHHHH
Confidence            77889999999999999999999999886   7999999999999999999999999999999999999999999986
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1hm6a_ 343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 3e-47
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 1e-13
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 4e-12
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 7e-11
d1axna_ 323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 4e-46
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 2e-15
d1axna_ 323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 1e-12
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 1e-11
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 2e-45
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 4e-15
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 2e-11
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 6e-11
d2ie7a1 318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 6e-45
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 4e-16
d2ie7a1 318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 8e-13
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 3e-12
d1dm5a_ 315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 2e-44
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 8e-15
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 2e-11
d1dm5a_ 315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 7e-11
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 1e-43
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 5e-15
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 1e-11
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 8e-09
d1w7ba_ 319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 2e-42
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 7e-15
d1w7ba_ 319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 2e-12
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 4e-11
d1i4aa_ 309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 2e-41
d1i4aa_ 309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 7e-15
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 1e-13
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 3e-09
d1n00a_ 318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 2e-40
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 1e-14
d1n00a_ 318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 1e-11
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 8e-11
d1bo9a_73 a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax 1e-23
d1bo9a_73 a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax 2e-09
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure

class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin I
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  155 bits (392), Expect = 3e-47
 Identities = 55/181 (30%), Positives = 79/181 (43%), Gaps = 39/181 (21%)

Query: 1   MGEQQYCRFDSSLGSTYRCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDV 60
             EQ+Y         T +         V P   F+P+ D E L  A+   G DE +II++
Sbjct: 15  NEEQEY-------IKTVKGSKGGPGSAVSPYPTFNPSSDVEALHKAITVKGVDEATIIEI 67

Query: 61  LAKRSNQQRQEIADAFKTLFGKEESFDPAVTTKLLYHNVIRHLFQCSIHCLPHQDLIDDL 120
           L KR+N QRQ+I  A+    GK                                 L + L
Sbjct: 68  LTKRTNAQRQQIKAAYLQEKGK--------------------------------PLDEAL 95

Query: 121 KSELGGNFEDAIVALMTPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEVY 180
           K  L G+ E+  +AL+    +  A EL  AM G+GTDE+ + EIL++ +N  IR I  VY
Sbjct: 96  KKALTGHLEEVALALLKTPAQFDADELRAAMKGLGTDEDTLNEILASRTNREIREINRVY 155

Query: 181 E 181
           +
Sbjct: 156 K 156
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1avca2321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1avca1341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1hm6a_343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1i4aa_309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1dm5a_315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 100.0
d1axna_323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n00a_318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 100.0
d1w7ba_319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2ie7a1318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1avca2 321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1dm5a_ 315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 100.0
d2ie7a1 318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1avca1 341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1hm6a_ 343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1axna_ 323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1w7ba_ 319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n00a_ 318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 99.98
d1i4aa_ 309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 99.11
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin VI
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=5.7e-39  Score=272.81  Aligned_cols=172  Identities=27%  Similarity=0.456  Sum_probs=148.6

Q ss_pred             cchHHhHHHhhhcchh-HhhhhccCccccCCCCCChHHHHHHHHHHHhcCCCCHHHHHHHHhcCCHHHHHHHHHHhhhhh
Q psy3631           2 GEQQYCRFDSSLGSTY-RCLFQQCLPTVVPADPFDPNGDAEVLRAAMKGFGTDEQSIIDVLAKRSNQQRQEIADAFKTLF   80 (184)
Q Consensus         2 ~~~~~~~~~~~~g~~~-~~~~~~~~~~i~~~~~~~~~~DA~~l~~A~kg~Gtde~~LieIL~~Rs~~ql~~Ik~~Y~~~y   80 (184)
                      |+||.++|+||++|.| ++|+..+.    +|    ++.||..|++||+|.||||.+|+||||+|||.|+.+|+++|+..|
T Consensus        60 g~dL~~~l~~e~sG~f~~~l~~l~~----~p----~~~dA~~l~~A~kG~gtde~~LieIl~trs~~el~~ik~aY~~~y  131 (321)
T d1avca2          60 GRDLMADLKSELSGDLARLILGLMM----PP----AHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIQAINKAYKEDY  131 (321)
T ss_dssp             SSCHHHHHHHHCCHHHHHHHHHHHS----CH----HHHHHHHHHHHTSSSSCCHHHHHHHHTTCCHHHHHHHHHHHHHHS
T ss_pred             CccHHHHHHHHhChhHHHHHHHHhC----Ch----hHHHHHHHHHHhhcCCchHHHHHHHHhcCCHHHHHHHHHHHHHHh
Confidence            8899999999995555 77766433    32    377999999999999999999999999999999999999999999


Q ss_pred             CCCCCCChhhhHHHHHHH----------------------------------------------------------HHHH
Q psy3631          81 GKEESFDPAVTTKLLYHN----------------------------------------------------------VIRH  102 (184)
Q Consensus        81 ~k~l~~d~~~~~~~l~~~----------------------------------------------------------~~~~  102 (184)
                      +++|++|+.++++.-|+.                                                          +++.
T Consensus       132 ~~~L~~di~~~~sG~~~~ll~~ll~~~R~e~~~~~~~a~~da~~~~~~~~l~~a~~g~~~tde~~~i~Il~~RS~~qL~~  211 (321)
T d1avca2         132 HKTLEDALSSDTSGHFKRILISLATGNREEGGEDRERAREDAQVAAEILEIADTTSGDKSSLETRFMMILCTRSYPDLRR  211 (321)
T ss_dssp             SSCHHHHHHHHCCHHHHHHHHHHTTCCCCCSCCCHHHHHHHHHHHHHHC--------------CHHHHHHHHSCHHHHHH
T ss_pred             cCcHHHHhHhhcCccHHHHHHHHHhcccccCCcchhhhhhhHHHHHHHHHHHHhccCCCcccHHHHhHhHhcCCHHHHHH
Confidence            999999988865333322                                                          1122


Q ss_pred             HHHhhhhcCCcCchHHHHhhhhcchHHHHHHHHh---CCChHHHHHHHHHhhcCCCCCHHHHHHHHHhCCHHHHHHHHHH
Q psy3631         103 LFQCSIHCLPHQDLIDDLKSELGGNFEDAIVALM---TPLPELYAKELHDAMSGVGTDEEAIVEILSTLSNYGIRTIAEV  179 (184)
Q Consensus       103 ~~~~~~~~~~~~~L~~~I~~e~sG~~~~~l~~l~---~~~~~~~A~~l~~Am~g~gtd~~~LirIlvsRse~dL~~Ik~~  179 (184)
                      +|+ .|+..+|++|+++|+++++|++++++++++   .+|+.|||+.||+||+|+|||+.+||||+++|+|+||..|+.+
T Consensus       212 i~~-~Y~~~~g~~l~~~i~~e~sG~~~~~l~~iv~~~~~~~~~~A~~L~~Am~G~Gtdd~~LiRiivsRse~dl~~Ik~~  290 (321)
T d1avca2         212 VFQ-EFVKMTNYDVEHTIKKEMSGDVRDVFVAIVQSVKNKPLFFADKLYKSMKGAGTEEKTLTRIMVSRSEIDLLNIRRE  290 (321)
T ss_dssp             HHH-HHHHHHSSCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSSSCCHHHHHHHHHHTTTTTHHHHHHH
T ss_pred             HHH-HHHHhcCchHHHHHHHhcCCCHHHHHHHHHHHHhccHHHHHHHHHHHhccCCCChhhheeeeeeccHHHHHHHHHH
Confidence            222 577789999999999999999999988775   7899999999999999999999999999999999999999999


Q ss_pred             Hhc
Q psy3631         180 YEN  182 (184)
Q Consensus       180 Y~~  182 (184)
                      |++
T Consensus       291 y~~  293 (321)
T d1avca2         291 FIE  293 (321)
T ss_dssp             HHH
T ss_pred             HHH
Confidence            986
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure