Diaphorina citri psyllid: psy3641


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MVTQNVHYLDSPLALPSEPPPVLENVANHQSQTQNQAQLLPEKKMLNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSVVCTRTPNANPSNELPLENSQMLDNYDQDSKVSGKEETSEHNPSKPTENSSSITELDPNKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY
cccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHcccc
************************************************************RRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSVVCTR*****************************************************************NLEHFKLGYQECLSESMHYLVEV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTQNVHYLDSPLALPSEPPPVLENVANHQSQTQNQAQLLPEKKMLNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSVVCTRTPNANPSNELPLENSQMLDNYDQDSKVSGKEETSEHNPSKPTENSSSITELDPNKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F3L, chain B
Confidence level:very confident
Coverage over the Query: 48-107
View the alignment between query and template
View the model in PyMOL
Template: 2DB7, chain A
Confidence level:probable
Coverage over the Query: 180-202
View the alignment between query and template
View the model in PyMOL