Psyllid ID: psy3641
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 345492563 | 491 | PREDICTED: hypothetical protein LOC10067 | 0.613 | 0.252 | 0.521 | 1e-34 | |
| 328714587 | 388 | PREDICTED: hypothetical protein LOC10057 | 0.727 | 0.378 | 0.467 | 1e-33 | |
| 345492561 | 463 | PREDICTED: hypothetical protein LOC10067 | 0.618 | 0.269 | 0.515 | 4e-33 | |
| 332022503 | 383 | Hairy/enhancer-of-split related with YRP | 0.608 | 0.321 | 0.487 | 9e-33 | |
| 110761895 | 400 | PREDICTED: hypothetical protein LOC72620 | 0.608 | 0.307 | 0.487 | 2e-32 | |
| 350418608 | 397 | PREDICTED: hypothetical protein LOC10074 | 0.603 | 0.307 | 0.481 | 4e-32 | |
| 380027321 | 374 | PREDICTED: uncharacterized protein LOC10 | 0.688 | 0.371 | 0.463 | 5e-32 | |
| 340722597 | 397 | PREDICTED: hypothetical protein LOC10065 | 0.603 | 0.307 | 0.481 | 5e-32 | |
| 383849130 | 397 | PREDICTED: uncharacterized protein LOC10 | 0.603 | 0.307 | 0.487 | 9e-32 | |
| 350418611 | 371 | PREDICTED: hypothetical protein LOC10074 | 0.702 | 0.382 | 0.436 | 2e-31 |
| >gi|345492563|ref|XP_003426878.1| PREDICTED: hypothetical protein LOC100679013 isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 151 bits (382), Expect = 1e-34, Method: Compositional matrix adjust.
Identities = 84/161 (52%), Positives = 100/161 (62%), Gaps = 37/161 (22%)
Query: 43 KKMLNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMK 102
KK ++R+DPMSHRIIEKRRRDRMNNCLADLSRLIPA+YLKKGRGR+EKTEIIEMAI+HMK
Sbjct: 60 KKKVSRQDPMSHRIIEKRRRDRMNNCLADLSRLIPAEYLKKGRGRVEKTEIIEMAIRHMK 119
Query: 103 YLHSVVCTRTPNANPSNELPLENSQMLDNYDQDSKVSGKEETSEHNPSKPTENSSSITEL 162
+L + QDSK H P + +
Sbjct: 120 HLQGL-------------------------RQDSK--------HHTPVSSVHAMHTEDSV 146
Query: 163 DP-NKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY 202
D + P GS A EH++LGYQECLSE+MH+LVEV+GY
Sbjct: 147 DSVSHPSTTGSSAA---EHYRLGYQECLSETMHFLVEVEGY 184
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328714587|ref|XP_003245398.1| PREDICTED: hypothetical protein LOC100570459 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|345492561|ref|XP_003426877.1| PREDICTED: hypothetical protein LOC100679013 isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332022503|gb|EGI62806.1| Hairy/enhancer-of-split related with YRPW motif protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|110761895|ref|XP_001121958.1| PREDICTED: hypothetical protein LOC726204 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350418608|ref|XP_003491913.1| PREDICTED: hypothetical protein LOC100743562 isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380027321|ref|XP_003697376.1| PREDICTED: uncharacterized protein LOC100868475 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340722597|ref|XP_003399690.1| PREDICTED: hypothetical protein LOC100652291 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383849130|ref|XP_003700199.1| PREDICTED: uncharacterized protein LOC100878396 isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350418611|ref|XP_003491914.1| PREDICTED: hypothetical protein LOC100743562 isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| FB|FBgn0259938 | 698 | cwo "clockwork orange" [Drosop | 0.297 | 0.085 | 0.8 | 2.8e-23 | |
| ZFIN|ZDB-GENE-040824-6 | 270 | helt "hey-like transcription f | 0.341 | 0.255 | 0.405 | 1.9e-17 | |
| UNIPROTKB|E1BP66 | 242 | LOC527932 "Uncharacterized pro | 0.331 | 0.276 | 0.417 | 2.9e-17 | |
| UNIPROTKB|B7ZMI7 | 242 | HELT "HELT protein" [Homo sapi | 0.331 | 0.276 | 0.417 | 2.9e-17 | |
| UNIPROTKB|J9P200 | 241 | HELT "Uncharacterized protein" | 0.292 | 0.244 | 0.457 | 4.8e-17 | |
| MGI|MGI:3040955 | 240 | Helt "helt bHLH transcription | 0.292 | 0.245 | 0.457 | 4.8e-17 | |
| RGD|1564073 | 240 | Helt "helt bHLH transcription | 0.292 | 0.245 | 0.457 | 4.8e-17 | |
| UNIPROTKB|E5RHK6 | 186 | HEY1 "Hairy/enhancer-of-split- | 0.252 | 0.274 | 0.529 | 1.1e-15 | |
| UNIPROTKB|F1NDT2 | 274 | HEY1 "Uncharacterized protein" | 0.252 | 0.186 | 0.529 | 3.6e-15 | |
| UNIPROTKB|J9P9B3 | 149 | HEY2 "Uncharacterized protein" | 0.252 | 0.342 | 0.509 | 4.5e-15 |
| FB|FBgn0259938 cwo "clockwork orange" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 257 (95.5 bits), Expect = 2.8e-23, Sum P(2) = 2.8e-23
Identities = 48/60 (80%), Positives = 56/60 (93%)
Query: 47 NREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHS 106
+R+DP+SHRIIEKRRRDRMN+CLADLSRLIP Y +KGRGRIEKTEIIEMAI+H+K+L S
Sbjct: 60 SRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQS 119
|
|
| ZFIN|ZDB-GENE-040824-6 helt "hey-like transcription factor" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BP66 LOC527932 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7ZMI7 HELT "HELT protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P200 HELT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3040955 Helt "helt bHLH transcription factor" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1564073 Helt "helt bHLH transcription factor" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E5RHK6 HEY1 "Hairy/enhancer-of-split-related with YRPW motif protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDT2 HEY1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P9B3 HEY2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 3e-12 | |
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 5e-11 | |
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 2e-07 |
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
Score = 58.6 bits (143), Expect = 3e-12
Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 4/54 (7%)
Query: 52 MSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLH 105
+H E+RRRDR+N+ +L L+P KK + K EI+ +AI+++K+L
Sbjct: 3 KAHNERERRRRDRINDAFEELRELLPTPPNKK----LSKAEILRLAIEYIKHLQ 52
|
Length = 52 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| KOG4304|consensus | 250 | 99.96 | ||
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.49 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.42 | |
| KOG1318|consensus | 411 | 99.37 | ||
| smart00353 | 53 | HLH helix loop helix domain. | 99.34 | |
| KOG1319|consensus | 229 | 98.99 | ||
| KOG3561|consensus | 803 | 98.94 | ||
| PF07527 | 43 | Hairy_orange: Hairy Orange; InterPro: IPR003650 Th | 98.74 | |
| smart00511 | 45 | ORANGE Orange domain. This domain confers specific | 98.56 | |
| KOG2588|consensus | 953 | 98.3 | ||
| KOG2483|consensus | 232 | 97.75 | ||
| KOG0561|consensus | 373 | 97.56 | ||
| KOG3560|consensus | 712 | 97.41 | ||
| KOG4029|consensus | 228 | 97.36 | ||
| KOG3960|consensus | 284 | 97.34 | ||
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 96.73 | |
| KOG3910|consensus | 632 | 95.04 | ||
| KOG3558|consensus | 768 | 94.22 | ||
| KOG4395|consensus | 285 | 90.95 | ||
| KOG3559|consensus | 598 | 88.97 |
| >KOG4304|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=5.9e-30 Score=224.24 Aligned_cols=99 Identities=30% Similarity=0.655 Sum_probs=85.3
Q ss_pred CCCCCCCcchHHHHHHHHHHHhHHHHHhhhhhhhhccC--CCCCcHHHHHHHHHHHHHHhHHhhccCCCCCCCCCCcccc
Q psy3641 47 NREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKG--RGRIEKTEIIEMAIKHMKYLHSVVCTRTPNANPSNELPLE 124 (202)
Q Consensus 47 ~r~rk~sh~~iEKrRRdRIN~~L~eLk~LvP~~~~~~~--~~KleKA~ILe~TV~ylk~Lq~~~~~~~~~~~~~~~~a~q 124 (202)
.-.||++|+++|||||||||+||++||+||++++.+++ ..|||||+|||+||+|||.|+........
T Consensus 29 ~~~rk~~Kpl~EKkRRaRIN~~L~eLK~Li~e~~~~~~~~~sklEKAdILEltV~hL~~l~~~~~~~~~----------- 97 (250)
T KOG4304|consen 29 RQYRKVRKPLLEKKRRARINRCLDELKDLIPEALKKDGQRHSKLEKADILELTVNHLRQLQRSQQAAAQ----------- 97 (250)
T ss_pred HHHhhhcchhHHHHHHHHHHHHHHHHHHHHHHHHhhcchhhhhhHHHHHHHHHHHHHHHHhcccccccc-----------
Confidence 34689999999999999999999999999999998874 59999999999999999999988633210
Q ss_pred cccccccccccccccCccccCCCCCCCCCCCCCCcccCCCCCCCCCCCCCCchhHHHHHHHHHHHHHHhhhhhcCCCC
Q psy3641 125 NSQMLDNYDQDSKVSGKEETSEHNPSKPTENSSSITELDPNKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY 202 (202)
Q Consensus 125 ~~q~l~~~~~d~~~~g~~~~~~~~p~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~y~~Gf~eC~~Ev~rfL~~~~G~ 202 (202)
+ .++....+.|++||.+|+.||+|||+.|||+
T Consensus 98 ----------~------------------------------------~~~~~~~d~f~~Gf~ec~~EVsr~ls~~~~~ 129 (250)
T KOG4304|consen 98 ----------A------------------------------------APAALPVDSFRAGFRECAAEVSRYLSICPGM 129 (250)
T ss_pred ----------c------------------------------------ccccccchhhhccHHHHHHHHHHHHhhCCCC
Confidence 0 0234678999999999999999999999996
|
|
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >KOG1318|consensus | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >KOG1319|consensus | Back alignment and domain information |
|---|
| >KOG3561|consensus | Back alignment and domain information |
|---|
| >PF07527 Hairy_orange: Hairy Orange; InterPro: IPR003650 This domain confers specificity among members of the Hairy/E(SPL) family | Back alignment and domain information |
|---|
| >smart00511 ORANGE Orange domain | Back alignment and domain information |
|---|
| >KOG2588|consensus | Back alignment and domain information |
|---|
| >KOG2483|consensus | Back alignment and domain information |
|---|
| >KOG0561|consensus | Back alignment and domain information |
|---|
| >KOG3560|consensus | Back alignment and domain information |
|---|
| >KOG4029|consensus | Back alignment and domain information |
|---|
| >KOG3960|consensus | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >KOG3910|consensus | Back alignment and domain information |
|---|
| >KOG3558|consensus | Back alignment and domain information |
|---|
| >KOG4395|consensus | Back alignment and domain information |
|---|
| >KOG3559|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 202 | ||||
| 4f3l_B | 387 | Crystal Structure Of The Heterodimeric Clock:bmal1 | 2e-04 | ||
| 4h10_A | 73 | Intermolecular Recognition Revealed By The Complex | 7e-04 |
| >pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 387 | Back alignment and structure |
|
| >pdb|4H10|A Chain A, Intermolecular Recognition Revealed By The Complex Structure Of Human Clock-bmal1 Basic Helix-loop-helix Domains With E-box Dna Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 4e-18 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 1e-12 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 1e-06 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 4e-06 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 9e-06 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 2e-05 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 6e-05 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 2e-04 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 9e-04 |
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 | Back alignment and structure |
|---|
Score = 74.1 bits (182), Expect = 4e-18
Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
Query: 52 MSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRI-EKTEIIEMAIKHMKYLHSVVCT 110
SH+ E+ RR+R+ L +L+ LIPA++ ++ K +E A +++++L T
Sbjct: 4 ESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNGST 63
|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.75 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.7 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.66 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.65 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.57 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.52 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.46 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.43 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.38 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.34 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 99.28 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 99.26 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.2 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 99.08 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 98.99 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.87 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.8 | |
| 2db7_A | 64 | Hairy/enhancer-OF-split related with YRPW motif 1; | 98.71 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 98.18 |
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
Probab=99.75 E-value=9.2e-19 Score=123.64 Aligned_cols=59 Identities=27% Similarity=0.405 Sum_probs=53.8
Q ss_pred CCCCcchHHHHHHHHHHHhHHHHHhhhhhhhhcc-CCCCCcHHHHHHHHHHHHHHhHHhh
Q psy3641 50 DPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKK-GRGRIEKTEIIEMAIKHMKYLHSVV 108 (202)
Q Consensus 50 rk~sh~~iEKrRRdRIN~~L~eLk~LvP~~~~~~-~~~KleKA~ILe~TV~ylk~Lq~~~ 108 (202)
++.+|+++||+||+|||.+|.+|+.|||.++..+ +..|++||+||++||+||+.|++++
T Consensus 2 kr~~H~~aEr~RR~rIn~~~~~L~~LlP~~~~~~~~~~k~sKa~iL~~Ai~YIk~Lq~~~ 61 (63)
T 1a0a_A 2 KRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNG 61 (63)
T ss_dssp CTTGGGGGTHHHHHHHHHHHHHHHHTSCHHHHTSSCCCCSCTTHHHHHHHHHHHHHHTCS
T ss_pred cccchhHHHHHHHHHHHHHHHHHHHHCCCcccccccCCcccHHHHHHHHHHHHHHHHHHh
Confidence 5789999999999999999999999999987654 3689999999999999999999875
|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db7_A Hairy/enhancer-OF-split related with YRPW motif 1; structural genomics, unknown function, DNA binding protein, NPPSFA; 1.90A {Homo sapiens} SCOP: a.273.1.1 | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 202 | ||||
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 7e-12 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 3e-11 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 1e-08 | |
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 6e-08 | |
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 4e-07 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 9e-07 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 1e-06 | |
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 0.002 |
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Usf B/HLH domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 56.3 bits (136), Expect = 7e-12
Identities = 16/61 (26%), Positives = 33/61 (54%)
Query: 46 LNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLH 105
++ + H +E+RRRD++NN + LS++IP ++ + K I+ A +++ L
Sbjct: 1 MDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDSSMESTKSGQSKGGILSKASDYIQELR 60
Query: 106 S 106
Sbjct: 61 Q 61
|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|