Psyllid ID: psy3641


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MVTQNVHYLDSPLALPSEPPPVLENVANHQSQTQNQAQLLPEKKMLNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSVVCTRTPNANPSNELPLENSQMLDNYDQDSKVSGKEETSEHNPSKPTENSSSITELDPNKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY
ccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHcccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccc
mvtqnvhyldsplalpsepppvlenvanhqsQTQNQAQllpekkmlnredpmshRIIEKRRRDRMNNCLAdlsrlipadylkkgrgrieKTEIIEMAIKHMKYLHSVVctrtpnanpsnelplensqmldnydqdskvsgkeetsehnpskptensssiteldpnkpegegspapinlehfKLGYQECLSESMHYLVEVKGY
mvtqnvhyldsplalpsEPPPVLENVANHQSQtqnqaqllpekkmlnredpmshriiekrrrdrMNNCladlsrlipadylkkgrgriEKTEIIEMAIKHMKYLHSVVCTRTPNANPSNELPLENSQMLDNYDQDSKVSGkeetsehnpskptensssiteldpNKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY
MVTQNVHYLDSPLALPSEPPPVLENVANHQSQTQNQAQLLPEKKMLNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSVVCTRTPNANPSNELPLENSQMLDNYDQDSKVSGKEETSEHNPSKPTENSSSITELDPNKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY
*****************************************************************NNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSVVCTR*****************************************************************NLEHFKLGYQECLSESMHYLVE****
************************************************************RRDRMNNCLADLSRLI***************EIIEMAIKHMKY**************************************************************************************SESMHYLVEV***
MVTQNVHYLDSPLALPSEPPPVLENVANHQSQTQNQAQLLPEKKMLNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSVVCTRTPNANPSNELPLENSQMLDNYD*************************************GSPAPINLEHFKLGYQECLSESMHYLVEVKGY
************LA*PSE*********************************MSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSVVCTRTP*********************************************************GSPAPINLEHFKLGYQECLSESMHYLVEVKGY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTQNVHYLDSPLALPSEPPPVLENVANHQSQTQNQAQLLPEKKMLNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSVVCTRTPNANPSNELPLENSQMLDNYDQDSKVSGKEETSEHNPSKPTENSSSITELDPNKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query202 2.2.26 [Sep-21-2011]
Q7TS99240 Hairy and enhancer of spl yes N/A 0.316 0.266 0.437 1e-11
Q6QB00270 Hairy and enhancer of spl yes N/A 0.346 0.259 0.4 1e-11
Q2KIN4 304 Hairy/enhancer-of-split r no N/A 0.257 0.171 0.519 3e-11
Q9TSZ2 304 Hairy/enhancer-of-split r yes N/A 0.257 0.171 0.519 3e-11
Q9Y5J3 304 Hairy/enhancer-of-split r yes N/A 0.257 0.171 0.519 3e-11
Q8AXV6 317 Hairy/enhancer-of-split r no N/A 0.257 0.164 0.519 3e-11
Q66KK8300 Hairy/enhancer-of-split r no N/A 0.257 0.173 0.519 4e-11
Q9I8A3294 Hairy/enhancer-of-split r N/A N/A 0.257 0.176 0.519 4e-11
Q9WV93299 Hairy/enhancer-of-split r no N/A 0.257 0.173 0.519 5e-11
Q9NQ87 328 Hairy/enhancer-of-split r no N/A 0.282 0.173 0.482 1e-10
>sp|Q7TS99|HELT_MOUSE Hairy and enhancer of split-related protein HELT OS=Mus musculus GN=Helt PE=1 SV=1 Back     alignment and function desciption
 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 45/64 (70%)

Query: 48  REDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHSV 107
           +  P+SH++IEKRRRDR+N CL +L + +P    K+  G++EK EI+EM +++++ LHS 
Sbjct: 9   KRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSA 68

Query: 108 VCTR 111
              R
Sbjct: 69  DFPR 72




Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'. Required for the development of GABAergic neurons.
Mus musculus (taxid: 10090)
>sp|Q6QB00|HELT_DANRE Hairy and enhancer of split-related protein helt OS=Danio rerio GN=helt PE=2 SV=1 Back     alignment and function description
>sp|Q2KIN4|HEY1_BOVIN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Bos taurus GN=HEY1 PE=2 SV=1 Back     alignment and function description
>sp|Q9TSZ2|HEY1_CANFA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Canis familiaris GN=HEY1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y5J3|HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens GN=HEY1 PE=1 SV=1 Back     alignment and function description
>sp|Q8AXV6|HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio GN=hey1 PE=2 SV=1 Back     alignment and function description
>sp|Q66KK8|HEY1_XENTR Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus tropicalis GN=hey1 PE=2 SV=1 Back     alignment and function description
>sp|Q9I8A3|HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis GN=hey1 PE=1 SV=1 Back     alignment and function description
>sp|Q9WV93|HEY1_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Mus musculus GN=Hey1 PE=1 SV=1 Back     alignment and function description
>sp|Q9NQ87|HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens GN=HEYL PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
345492563 491 PREDICTED: hypothetical protein LOC10067 0.613 0.252 0.521 1e-34
328714587 388 PREDICTED: hypothetical protein LOC10057 0.727 0.378 0.467 1e-33
345492561 463 PREDICTED: hypothetical protein LOC10067 0.618 0.269 0.515 4e-33
332022503 383 Hairy/enhancer-of-split related with YRP 0.608 0.321 0.487 9e-33
110761895 400 PREDICTED: hypothetical protein LOC72620 0.608 0.307 0.487 2e-32
350418608 397 PREDICTED: hypothetical protein LOC10074 0.603 0.307 0.481 4e-32
380027321 374 PREDICTED: uncharacterized protein LOC10 0.688 0.371 0.463 5e-32
340722597 397 PREDICTED: hypothetical protein LOC10065 0.603 0.307 0.481 5e-32
383849130 397 PREDICTED: uncharacterized protein LOC10 0.603 0.307 0.487 9e-32
350418611 371 PREDICTED: hypothetical protein LOC10074 0.702 0.382 0.436 2e-31
>gi|345492563|ref|XP_003426878.1| PREDICTED: hypothetical protein LOC100679013 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 100/161 (62%), Gaps = 37/161 (22%)

Query: 43  KKMLNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMK 102
           KK ++R+DPMSHRIIEKRRRDRMNNCLADLSRLIPA+YLKKGRGR+EKTEIIEMAI+HMK
Sbjct: 60  KKKVSRQDPMSHRIIEKRRRDRMNNCLADLSRLIPAEYLKKGRGRVEKTEIIEMAIRHMK 119

Query: 103 YLHSVVCTRTPNANPSNELPLENSQMLDNYDQDSKVSGKEETSEHNPSKPTENSSSITEL 162
           +L  +                          QDSK         H P        +   +
Sbjct: 120 HLQGL-------------------------RQDSK--------HHTPVSSVHAMHTEDSV 146

Query: 163 DP-NKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY 202
           D  + P   GS A    EH++LGYQECLSE+MH+LVEV+GY
Sbjct: 147 DSVSHPSTTGSSAA---EHYRLGYQECLSETMHFLVEVEGY 184




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328714587|ref|XP_003245398.1| PREDICTED: hypothetical protein LOC100570459 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345492561|ref|XP_003426877.1| PREDICTED: hypothetical protein LOC100679013 isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332022503|gb|EGI62806.1| Hairy/enhancer-of-split related with YRPW motif protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|110761895|ref|XP_001121958.1| PREDICTED: hypothetical protein LOC726204 [Apis mellifera] Back     alignment and taxonomy information
>gi|350418608|ref|XP_003491913.1| PREDICTED: hypothetical protein LOC100743562 isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380027321|ref|XP_003697376.1| PREDICTED: uncharacterized protein LOC100868475 [Apis florea] Back     alignment and taxonomy information
>gi|340722597|ref|XP_003399690.1| PREDICTED: hypothetical protein LOC100652291 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383849130|ref|XP_003700199.1| PREDICTED: uncharacterized protein LOC100878396 isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350418611|ref|XP_003491914.1| PREDICTED: hypothetical protein LOC100743562 isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
FB|FBgn0259938 698 cwo "clockwork orange" [Drosop 0.297 0.085 0.8 2.8e-23
ZFIN|ZDB-GENE-040824-6270 helt "hey-like transcription f 0.341 0.255 0.405 1.9e-17
UNIPROTKB|E1BP66242 LOC527932 "Uncharacterized pro 0.331 0.276 0.417 2.9e-17
UNIPROTKB|B7ZMI7242 HELT "HELT protein" [Homo sapi 0.331 0.276 0.417 2.9e-17
UNIPROTKB|J9P200241 HELT "Uncharacterized protein" 0.292 0.244 0.457 4.8e-17
MGI|MGI:3040955240 Helt "helt bHLH transcription 0.292 0.245 0.457 4.8e-17
RGD|1564073240 Helt "helt bHLH transcription 0.292 0.245 0.457 4.8e-17
UNIPROTKB|E5RHK6186 HEY1 "Hairy/enhancer-of-split- 0.252 0.274 0.529 1.1e-15
UNIPROTKB|F1NDT2 274 HEY1 "Uncharacterized protein" 0.252 0.186 0.529 3.6e-15
UNIPROTKB|J9P9B3149 HEY2 "Uncharacterized protein" 0.252 0.342 0.509 4.5e-15
FB|FBgn0259938 cwo "clockwork orange" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 257 (95.5 bits), Expect = 2.8e-23, Sum P(2) = 2.8e-23
 Identities = 48/60 (80%), Positives = 56/60 (93%)

Query:    47 NREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLHS 106
             +R+DP+SHRIIEKRRRDRMN+CLADLSRLIP  Y +KGRGRIEKTEIIEMAI+H+K+L S
Sbjct:    60 SRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQS 119


GO:0005634 "nucleus" evidence=IDA;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003677 "DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0042752 "regulation of circadian rhythm" evidence=IMP
GO:0032922 "circadian regulation of gene expression" evidence=IMP
ZFIN|ZDB-GENE-040824-6 helt "hey-like transcription factor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP66 LOC527932 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZMI7 HELT "HELT protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P200 HELT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:3040955 Helt "helt bHLH transcription factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564073 Helt "helt bHLH transcription factor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E5RHK6 HEY1 "Hairy/enhancer-of-split-related with YRPW motif protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDT2 HEY1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9B3 HEY2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 3e-12
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 5e-11
smart0035353 smart00353, HLH, helix loop helix domain 2e-07
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information
 Score = 58.6 bits (143), Expect = 3e-12
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 52  MSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLH 105
            +H   E+RRRDR+N+   +L  L+P    KK    + K EI+ +AI+++K+L 
Sbjct: 3   KAHNERERRRRDRINDAFEELRELLPTPPNKK----LSKAEILRLAIEYIKHLQ 52


Length = 52

>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
KOG4304|consensus 250 99.96
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.49
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.42
KOG1318|consensus411 99.37
smart0035353 HLH helix loop helix domain. 99.34
KOG1319|consensus229 98.99
KOG3561|consensus 803 98.94
PF0752743 Hairy_orange: Hairy Orange; InterPro: IPR003650 Th 98.74
smart0051145 ORANGE Orange domain. This domain confers specific 98.56
KOG2588|consensus 953 98.3
KOG2483|consensus232 97.75
KOG0561|consensus 373 97.56
KOG3560|consensus 712 97.41
KOG4029|consensus228 97.36
KOG3960|consensus284 97.34
PLN0321793 transcription factor ATBS1; Provisional 96.73
KOG3910|consensus632 95.04
KOG3558|consensus 768 94.22
KOG4395|consensus285 90.95
KOG3559|consensus 598 88.97
>KOG4304|consensus Back     alignment and domain information
Probab=99.96  E-value=5.9e-30  Score=224.24  Aligned_cols=99  Identities=30%  Similarity=0.655  Sum_probs=85.3

Q ss_pred             CCCCCCCcchHHHHHHHHHHHhHHHHHhhhhhhhhccC--CCCCcHHHHHHHHHHHHHHhHHhhccCCCCCCCCCCcccc
Q psy3641          47 NREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKG--RGRIEKTEIIEMAIKHMKYLHSVVCTRTPNANPSNELPLE  124 (202)
Q Consensus        47 ~r~rk~sh~~iEKrRRdRIN~~L~eLk~LvP~~~~~~~--~~KleKA~ILe~TV~ylk~Lq~~~~~~~~~~~~~~~~a~q  124 (202)
                      .-.||++|+++|||||||||+||++||+||++++.+++  ..|||||+|||+||+|||.|+........           
T Consensus        29 ~~~rk~~Kpl~EKkRRaRIN~~L~eLK~Li~e~~~~~~~~~sklEKAdILEltV~hL~~l~~~~~~~~~-----------   97 (250)
T KOG4304|consen   29 RQYRKVRKPLLEKKRRARINRCLDELKDLIPEALKKDGQRHSKLEKADILELTVNHLRQLQRSQQAAAQ-----------   97 (250)
T ss_pred             HHHhhhcchhHHHHHHHHHHHHHHHHHHHHHHHHhhcchhhhhhHHHHHHHHHHHHHHHHhcccccccc-----------
Confidence            34689999999999999999999999999999998874  59999999999999999999988633210           


Q ss_pred             cccccccccccccccCccccCCCCCCCCCCCCCCcccCCCCCCCCCCCCCCchhHHHHHHHHHHHHHHhhhhhcCCCC
Q psy3641         125 NSQMLDNYDQDSKVSGKEETSEHNPSKPTENSSSITELDPNKPEGEGSPAPINLEHFKLGYQECLSESMHYLVEVKGY  202 (202)
Q Consensus       125 ~~q~l~~~~~d~~~~g~~~~~~~~p~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~y~~Gf~eC~~Ev~rfL~~~~G~  202 (202)
                                +                                    .++....+.|++||.+|+.||+|||+.|||+
T Consensus        98 ----------~------------------------------------~~~~~~~d~f~~Gf~ec~~EVsr~ls~~~~~  129 (250)
T KOG4304|consen   98 ----------A------------------------------------APAALPVDSFRAGFRECAAEVSRYLSICPGM  129 (250)
T ss_pred             ----------c------------------------------------ccccccchhhhccHHHHHHHHHHHHhhCCCC
Confidence                      0                                    0234678999999999999999999999996



>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>KOG1318|consensus Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1319|consensus Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>PF07527 Hairy_orange: Hairy Orange; InterPro: IPR003650 This domain confers specificity among members of the Hairy/E(SPL) family Back     alignment and domain information
>smart00511 ORANGE Orange domain Back     alignment and domain information
>KOG2588|consensus Back     alignment and domain information
>KOG2483|consensus Back     alignment and domain information
>KOG0561|consensus Back     alignment and domain information
>KOG3560|consensus Back     alignment and domain information
>KOG4029|consensus Back     alignment and domain information
>KOG3960|consensus Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>KOG3910|consensus Back     alignment and domain information
>KOG3558|consensus Back     alignment and domain information
>KOG4395|consensus Back     alignment and domain information
>KOG3559|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
4f3l_B 387 Crystal Structure Of The Heterodimeric Clock:bmal1 2e-04
4h10_A73 Intermolecular Recognition Revealed By The Complex 7e-04
>pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 387 Back     alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Query: 53 SHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYL 104 +H IEKRRRD+MN+ + +L+ L+P +++K ++ MA++HMK L Sbjct: 16 AHSQIEKRRRDKMNSFIDELASLVPT--CNAMSRKLDKLTVLRMAVQHMKTL 65
>pdb|4H10|A Chain A, Intermolecular Recognition Revealed By The Complex Structure Of Human Clock-bmal1 Basic Helix-loop-helix Domains With E-box Dna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
1a0a_A63 BHLH, protein (phosphate system positive regulator 4e-18
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 1e-12
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 1e-06
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 4e-06
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 9e-06
4f3l_A 361 Mclock, circadian locomoter output cycles protein 2e-05
1hlo_A80 Protein (transcription factor MAX); transcriptiona 6e-05
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 2e-04
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 9e-04
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure
 Score = 74.1 bits (182), Expect = 4e-18
 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 52  MSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRI-EKTEIIEMAIKHMKYLHSVVCT 110
            SH+  E+ RR+R+   L +L+ LIPA++ ++       K   +E A +++++L     T
Sbjct: 4   ESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNGST 63


>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.75
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.7
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.66
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.65
4ati_A118 MITF, microphthalmia-associated transcription fact 99.57
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.52
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.46
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.43
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.38
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.34
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.28
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.26
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.2
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.08
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 98.99
4ath_A83 MITF, microphthalmia-associated transcription fact 98.87
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.8
2db7_A64 Hairy/enhancer-OF-split related with YRPW motif 1; 98.71
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.18
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
Probab=99.75  E-value=9.2e-19  Score=123.64  Aligned_cols=59  Identities=27%  Similarity=0.405  Sum_probs=53.8

Q ss_pred             CCCCcchHHHHHHHHHHHhHHHHHhhhhhhhhcc-CCCCCcHHHHHHHHHHHHHHhHHhh
Q psy3641          50 DPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKK-GRGRIEKTEIIEMAIKHMKYLHSVV  108 (202)
Q Consensus        50 rk~sh~~iEKrRRdRIN~~L~eLk~LvP~~~~~~-~~~KleKA~ILe~TV~ylk~Lq~~~  108 (202)
                      ++.+|+++||+||+|||.+|.+|+.|||.++..+ +..|++||+||++||+||+.|++++
T Consensus         2 kr~~H~~aEr~RR~rIn~~~~~L~~LlP~~~~~~~~~~k~sKa~iL~~Ai~YIk~Lq~~~   61 (63)
T 1a0a_A            2 KRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQNG   61 (63)
T ss_dssp             CTTGGGGGTHHHHHHHHHHHHHHHHTSCHHHHTSSCCCCSCTTHHHHHHHHHHHHHHTCS
T ss_pred             cccchhHHHHHHHHHHHHHHHHHHHHCCCcccccccCCcccHHHHHHHHHHHHHHHHHHh
Confidence            5789999999999999999999999999987654 3689999999999999999999875



>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2db7_A Hairy/enhancer-OF-split related with YRPW motif 1; structural genomics, unknown function, DNA binding protein, NPPSFA; 1.90A {Homo sapiens} SCOP: a.273.1.1 Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 7e-12
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 3e-11
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 1e-08
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 6e-08
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 4e-07
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 9e-07
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 1e-06
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 0.002
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Usf B/HLH domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 56.3 bits (136), Expect = 7e-12
 Identities = 16/61 (26%), Positives = 33/61 (54%)

Query: 46  LNREDPMSHRIIEKRRRDRMNNCLADLSRLIPADYLKKGRGRIEKTEIIEMAIKHMKYLH 105
           ++ +    H  +E+RRRD++NN +  LS++IP   ++  +    K  I+  A  +++ L 
Sbjct: 1   MDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDSSMESTKSGQSKGGILSKASDYIQELR 60

Query: 106 S 106
            
Sbjct: 61  Q 61


>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure