Diaphorina citri psyllid: psy3643


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MRTGTYNVFMEYCTCMSKDGCNTASLPNMSPIFTVVISAVSCIKCWNCRSDSDPKCADPFDNSSIPINDCKVEPELSHLPGIRATMCRKIRQKVHGEWRYYRGCAWLGEPGIGGDERYCLMRTGTYNVFMEYCTCMSKDGCNTASLPNMSPIF
cccccEEEEEEEEECcccccccccccccHHcEEEEEcccccccEEEEcccccccccccccccccccccccccccccccccccccccEEEEEEEEccEEEEEEcccccccccccccccccccccccccEEEEEEEEcccccccccccccccccc
***GTYNVFMEYCTCMSKDGCNTASLPNMSPIFTVVISAVSCIKCWNCRSDSDPKCADPFDNSSIPINDCKVEPELSHLPGIRATMCRKIRQKVHGEWRYYRGCAWLGEPGIGGDERYCLMRTGTYNVFMEYCTCMSKDGCNTASL****PIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTGTYNVFMEYCTCMSKDGCNTASLPNMSPIFTVVISAVSCIKCWNCRSDSDPKCADPFDNSSIPINDCKVEPELSHLPGIRATMCRKIRQKVHGEWRYYRGCAWLGEPGIGGDERYCLMRTGTYNVFMEYCTCMSKDGCNTASLPNMSPIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0019991 [BP]septate junction assemblyprobableGO:0022607, GO:0034330, GO:0016043, GO:0034329, GO:0008150, GO:0044085, GO:0007043, GO:0071840, GO:0045216, GO:0044763, GO:0009987, GO:0043297, GO:0044699
GO:0035151 [BP]regulation of tube size, open tracheal systemprobableGO:0035150, GO:0007424, GO:0035152, GO:0032501, GO:0044707, GO:0060541, GO:0048856, GO:0090066, GO:0008150, GO:0065007, GO:0048731, GO:0065008, GO:0032502, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YWH, chain A
Confidence level:confident
Coverage over the Query: 10-72,83-144
View the alignment between query and template
View the model in PyMOL