Diaphorina citri psyllid: psy3654


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MSGSPLPFENKKPALSSPMLSPQEPHLHSNNTLSLPSPIITRRTRTESISNRALQNPVETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTPEVHLQWDSPSP
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEcEEEEEcccccEEEEccccccccEEEEEEccccccccccccEEEEEEEEcccccccccEEEEEEEEcccccccccccccc
************************************************************GKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTP***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGSPLPFENKKPALSSPMLSPQEPHLHSNNTLSLPSPIITRRTRTESISNRALQNPVETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTPEVHLQWDSPSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cold shock domain-containing protein CG9705 very confidentQ9VVA0
Calcium-regulated heat stable protein 1 Binds mRNA and regulates the stability of target mRNA.confidentQ9WU49
Calcium-regulated heat stable protein 1 Binds mRNA and regulates the stability of target mRNA. Binds single-stranded DNA (in vitro).confidentQ9Y2V2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043186 [CC]P granuleconfidentGO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0003730 [MF]mRNA 3'-UTR bindingconfidentGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0000177 [CC]cytoplasmic exosome (RNase complex)confidentGO:0005737, GO:0043234, GO:0000178, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043488 [BP]regulation of mRNA stabilityprobableGO:0019222, GO:0043487, GO:0010608, GO:0050789, GO:0060255, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0001072 [MF]RNA binding transcription antitermination factor activityprobableGO:0003674, GO:0001070, GO:0001071
GO:0016020 [CC]membraneprobableGO:0005575
GO:0019722 [BP]calcium-mediated signalingprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0019902 [MF]phosphatase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0031564 [BP]transcription antiterminationprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0051128, GO:0043244, GO:0031554, GO:0050789, GO:2000112, GO:0031555, GO:0060255, GO:0065007, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051252, GO:0006355, GO:0010556
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0060567 [BP]negative regulation of DNA-dependent transcription, terminationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0051129, GO:0051128, GO:0010629, GO:0043244, GO:0031554, GO:0050789, GO:0044699, GO:0043242, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0019219, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0045892, GO:0010558, GO:0048523
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0009409 [BP]response to coldprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0006397 [BP]mRNA processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AQQ, chain A
Confidence level:very confident
Coverage over the Query: 37-136
View the alignment between query and template
View the model in PyMOL