Psyllid ID: psy3654

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MSGSPLPFENKKPALSSPMLSPQEPHLHSNNTLSLPSPIITRRTRTESISNRALQNPVETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTPEVHLQWDSPSP
cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccEEcEEEEEcccccEEEEccccccccEEEEEEccccccccccccEEEEEEEEcccccccccEEEEEEEEcccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEEEEEEEEccccEEEEEEccccccEEEEHHHEccccccccccEEEEEEEEcccccccEEEEEEEEEEcccccccccccccc
msgsplpfenkkpalsspmlspqephlhsnntlslpspiitrrtrtesisnralqnpvetgkIKEFcrskghgfitpdsgepavfvhisdiegcyvplpgdevkyrlcpippkfeknqAVHVEIVHLtpevhlqwdspsp
msgsplpfenkkpalsspMLSPQEPHLhsnntlslpspiITRRtrtesisnralqnpvetgkIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLtpevhlqwdspsp
MSGSPLPFENKKPALSSPMLSPQEPHLHSNNTLSLPSPIITRRTRTESISNRALQNPVETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTPEVHLQWDSPSP
**************************************************************IKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTPEVHLQW*****
************************************************************GKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKY****************VEIV***************
*********NKKPALSSPMLSPQEPHLHSNNTLSLPSPIITRRTRTESISNRALQNPVETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTPEVH********
*************************************P**TR**RTESISNRALQNPVETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTP***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGSPLPFENKKPALSSPMLSPQEPHLHSNNTLSLPSPIITRRTRTESISNRALQNPVETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTPEVHLQWDSPSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
Q9VVA0143 Cold shock domain-contain yes N/A 0.857 0.839 0.656 3e-42
Q9Y2V2147 Calcium-regulated heat st yes N/A 0.721 0.687 0.617 1e-28
Q9WU49147 Calcium-regulated heat st yes N/A 0.721 0.687 0.617 1e-28
Q9CR86148 Calcium-regulated heat st yes N/A 0.721 0.682 0.617 1e-28
Q63430154 Cold shock domain-contain no N/A 0.728 0.662 0.563 1e-26
Q9Y534153 Cold shock domain-contain no N/A 0.735 0.673 0.557 1e-26
Q91YQ3154 Cold shock domain-contain no N/A 0.735 0.668 0.557 2e-26
P5539069 Probable cold shock prote yes N/A 0.371 0.753 0.425 8e-05
P5740769 Cold shock-like protein C yes N/A 0.235 0.478 0.575 0.0006
Q9Z3S669 Cold shock protein CspA O no N/A 0.364 0.739 0.396 0.0007
>sp|Q9VVA0|Y9705_DROME Cold shock domain-containing protein CG9705 OS=Drosophila melanogaster GN=CG9705 PE=1 SV=1 Back     alignment and function desciption
 Score =  169 bits (429), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 82/125 (65%), Positives = 99/125 (79%), Gaps = 5/125 (4%)

Query: 19  MLSPQEPHLHSNN-----TLSLPSPIITRRTRTESISNRALQNPVETGKIKEFCRSKGHG 73
           +L+ + P LH N+     +L LPSPIITRRTRT S S RAL+NPV TG +K F R+KGHG
Sbjct: 10  LLAAKPPVLHHNSHSPNASLQLPSPIITRRTRTASTSARALENPVVTGMVKSFSRTKGHG 69

Query: 74  FITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTPEVHL 133
           FITP++G   VF H+SDIEG YVP+PGDEVKYRLC IPPK+EK+QAVHV+I HLTPEVH 
Sbjct: 70  FITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQISHLTPEVHH 129

Query: 134 QWDSP 138
           +W+ P
Sbjct: 130 KWEEP 134

Drosophila melanogaster (taxid: 7227)
>sp|Q9Y2V2|CHSP1_HUMAN Calcium-regulated heat stable protein 1 OS=Homo sapiens GN=CARHSP1 PE=1 SV=2 Back     alignment and function description
>sp|Q9WU49|CHSP1_RAT Calcium-regulated heat stable protein 1 OS=Rattus norvegicus GN=Carhsp1 PE=1 SV=1 Back     alignment and function description
>sp|Q9CR86|CHSP1_MOUSE Calcium-regulated heat stable protein 1 OS=Mus musculus GN=Carhsp1 PE=1 SV=1 Back     alignment and function description
>sp|Q63430|CSDC2_RAT Cold shock domain-containing protein C2 OS=Rattus norvegicus GN=Csdc2 PE=2 SV=3 Back     alignment and function description
>sp|Q9Y534|CSDC2_HUMAN Cold shock domain-containing protein C2 OS=Homo sapiens GN=CSDC2 PE=2 SV=1 Back     alignment and function description
>sp|Q91YQ3|CSDC2_MOUSE Cold shock domain-containing protein C2 OS=Mus musculus GN=Csdc2 PE=2 SV=2 Back     alignment and function description
>sp|P55390|Y4CH_RHISN Probable cold shock protein y4cH OS=Rhizobium sp. (strain NGR234) GN=NGR_a00060 PE=4 SV=1 Back     alignment and function description
>sp|P57407|CSPC_BUCAI Cold shock-like protein CspC OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cspC PE=3 SV=2 Back     alignment and function description
>sp|Q9Z3S6|CSPA_RHIME Cold shock protein CspA OS=Rhizobium meliloti (strain 1021) GN=cspA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
242022944132 calcium-regulated heat stable protein, p 0.892 0.946 0.671 9e-44
389609929129 similar to CG9705 [Papilio xuthus] 0.785 0.852 0.727 3e-41
195328232143 GM25657 [Drosophila sechellia] gi|195590 0.857 0.839 0.656 2e-40
21356601143 CG9705, isoform A [Drosophila melanogast 0.857 0.839 0.656 3e-40
242246995135 calcium-regulated heat stable protein 1 0.735 0.762 0.757 8e-40
158294527157 AGAP005641-PA [Anopheles gambiae str. PE 0.75 0.668 0.714 2e-39
357603731127 hypothetical protein KGM_10424 [Danaus p 0.814 0.897 0.686 5e-39
125977582142 GA21978 [Drosophila pseudoobscura pseudo 0.857 0.845 0.656 5e-39
195376475142 GJ13199 [Drosophila virilis] gi|19415418 0.842 0.830 0.658 7e-39
195495012143 GE19874 [Drosophila yakuba] gi|194181187 0.778 0.762 0.706 1e-38
>gi|242022944|ref|XP_002431897.1| calcium-regulated heat stable protein, putative [Pediculus humanus corporis] gi|212517238|gb|EEB19159.1| calcium-regulated heat stable protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  181 bits (459), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 101/128 (78%), Gaps = 3/128 (2%)

Query: 10  NKKPALSSPMLSPQEPHLHSNNTLSLPSPIITRRTRTESISNRALQNPVETGKIKEFCRS 69
           NKK +LS  + +P EP++     LSLPSPIITRRTRT S S +A +NP+E G +K FCR 
Sbjct: 2   NKKASLSDSITTPTEPYIKH---LSLPSPIITRRTRTNSTSAKAFENPIEKGTVKMFCRE 58

Query: 70  KGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTP 129
           KGHGFIT +     +FVHISDIEG YVPLPGDEV+YRLCPIPPKFEK QAVHV I+HLTP
Sbjct: 59  KGHGFITSNRTGEDIFVHISDIEGEYVPLPGDEVEYRLCPIPPKFEKTQAVHVNIIHLTP 118

Query: 130 EVHLQWDS 137
           EVH++WDS
Sbjct: 119 EVHVKWDS 126

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|389609929|dbj|BAM18576.1| similar to CG9705 [Papilio xuthus] Back     alignment and taxonomy information
>gi|195328232|ref|XP_002030820.1| GM25657 [Drosophila sechellia] gi|195590920|ref|XP_002085192.1| GD14664 [Drosophila simulans] gi|194119763|gb|EDW41806.1| GM25657 [Drosophila sechellia] gi|194197201|gb|EDX10777.1| GD14664 [Drosophila simulans] Back     alignment and taxonomy information
>gi|21356601|ref|NP_648920.1| CG9705, isoform A [Drosophila melanogaster] gi|24665520|ref|NP_730197.1| CG9705, isoform B [Drosophila melanogaster] gi|442632925|ref|NP_001261972.1| CG9705, isoform C [Drosophila melanogaster] gi|75027588|sp|Q9VVA0.1|Y9705_DROME RecName: Full=Cold shock domain-containing protein CG9705 gi|7294059|gb|AAF49414.1| CG9705, isoform A [Drosophila melanogaster] gi|16648430|gb|AAL25480.1| LD47312p [Drosophila melanogaster] gi|23093318|gb|AAN11740.1| CG9705, isoform B [Drosophila melanogaster] gi|220956110|gb|ACL90598.1| CG9705-PA [synthetic construct] gi|440215920|gb|AGB94665.1| CG9705, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|242246995|ref|NP_001156264.1| calcium-regulated heat stable protein 1 [Acyrthosiphon pisum] gi|239789112|dbj|BAH71202.1| ACYPI008400 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|158294527|ref|XP_315660.4| AGAP005641-PA [Anopheles gambiae str. PEST] gi|157015604|gb|EAA11357.4| AGAP005641-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|357603731|gb|EHJ63898.1| hypothetical protein KGM_10424 [Danaus plexippus] Back     alignment and taxonomy information
>gi|125977582|ref|XP_001352824.1| GA21978 [Drosophila pseudoobscura pseudoobscura] gi|195169856|ref|XP_002025730.1| GL20690 [Drosophila persimilis] gi|54641575|gb|EAL30325.1| GA21978 [Drosophila pseudoobscura pseudoobscura] gi|194109223|gb|EDW31266.1| GL20690 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195376475|ref|XP_002047022.1| GJ13199 [Drosophila virilis] gi|194154180|gb|EDW69364.1| GJ13199 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195495012|ref|XP_002095086.1| GE19874 [Drosophila yakuba] gi|194181187|gb|EDW94798.1| GE19874 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
FB|FBgn0036661143 CG9705 [Drosophila melanogaste 0.907 0.888 0.628 4.6e-41
UNIPROTKB|Q2NKU4147 CARHSP1 "Uncharacterized prote 0.957 0.911 0.517 3.4e-29
UNIPROTKB|I3LCU9158 CARHSP1 "Uncharacterized prote 0.964 0.854 0.517 5.6e-29
MGI|MGI:1196368148 Carhsp1 "calcium regulated hea 0.85 0.804 0.549 1.2e-28
RGD|708415147 Carhsp1 "calcium regulated hea 0.85 0.809 0.549 1.2e-28
UNIPROTKB|E2R913154 CARHSP1 "Uncharacterized prote 0.957 0.870 0.517 1.5e-28
UNIPROTKB|Q9Y2V2147 CARHSP1 "Calcium-regulated hea 0.85 0.809 0.549 1.5e-28
UNIPROTKB|E1C8P8152 CARHSP1 "Uncharacterized prote 0.857 0.789 0.541 1.9e-28
UNIPROTKB|H3BNU9131 CARHSP1 "Calcium-regulated hea 0.792 0.847 0.566 2.2e-27
UNIPROTKB|Q9Y534153 CSDC2 "Cold shock domain-conta 0.721 0.660 0.568 7.3e-27
FB|FBgn0036661 CG9705 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 436 (158.5 bits), Expect = 4.6e-41, P = 4.6e-41
 Identities = 83/132 (62%), Positives = 101/132 (76%)

Query:    12 KPALSSPMLSPQEPHLHSNN-----TLSLPSPIITRRTRTESISNRALQNPVETGKIKEF 66
             +P     +L+ + P LH N+     +L LPSPIITRRTRT S S RAL+NPV TG +K F
Sbjct:     3 EPRTPEKLLAAKPPVLHHNSHSPNASLQLPSPIITRRTRTASTSARALENPVVTGMVKSF 62

Query:    67 CRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVH 126
              R+KGHGFITP++G   VF H+SDIEG YVP+PGDEVKYRLC IPPK+EK+QAVHV+I H
Sbjct:    63 SRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQISH 122

Query:   127 LTPEVHLQWDSP 138
             LTPEVH +W+ P
Sbjct:   123 LTPEVHHKWEEP 134
GO:0005575 "cellular_component" evidence=ND
GO:0003677 "DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
UNIPROTKB|Q2NKU4 CARHSP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LCU9 CARHSP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1196368 Carhsp1 "calcium regulated heat stable protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708415 Carhsp1 "calcium regulated heat stable protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R913 CARHSP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2V2 CARHSP1 "Calcium-regulated heat stable protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8P8 CARHSP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H3BNU9 CARHSP1 "Calcium-regulated heat stable protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y534 CSDC2 "Cold shock domain-containing protein C2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9WU49CHSP1_RATNo assigned EC number0.61760.72140.6870yesN/A
Q9CR86CHSP1_MOUSENo assigned EC number0.61760.72140.6824yesN/A
Q9VVA0Y9705_DROMENo assigned EC number0.6560.85710.8391yesN/A
Q9Y2V2CHSP1_HUMANNo assigned EC number0.61760.72140.6870yesN/A
P57407CSPC_BUCAINo assigned EC number0.57570.23570.4782yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
cd0445865 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contain 7e-19
smart0035764 smart00357, CSP, Cold shock protein domain 3e-12
COG127867 COG1278, CspC, Cold shock proteins [Transcription] 1e-11
pfam0031366 pfam00313, CSD, 'Cold-shock' DNA-binding domain 1e-09
PRK1094369 PRK10943, PRK10943, cold shock-like protein CspC; 6e-07
PRK1035470 PRK10354, PRK10354, RNA chaperone/anti-terminator; 1e-06
TIGR0238168 TIGR02381, cspD, cold shock domain protein CspD 3e-06
PRK0950769 PRK09507, cspE, cold shock protein CspE; Reviewed 4e-06
PRK0989070 PRK09890, PRK09890, cold shock protein CspG; Provi 1e-05
PRK1499873 PRK14998, PRK14998, cold shock-like protein CspD; 2e-04
PRK0993774 PRK09937, PRK09937, stationary phase/starvation in 0.001
>gnl|CDD|239905 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea Back     alignment and domain information 
 Score = 74.5 bits (184), Expect = 7e-19
 Identities = 29/67 (43%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 60  TGKIKEFCRSKGHGFITPDSGEPAVFVHISDIE--GCYVPLPGDEVKYRLCPIPPKFEKN 117
           TG +K F   KG GFITPD G   VFVHIS +E  G      GD V++ L          
Sbjct: 2   TGTVKWFDDEKGFGFITPDDGGEDVFVHISALEGDGFRSLEEGDRVEFELEEGDKGP--- 58

Query: 118 QAVHVEI 124
           QAV+V +
Sbjct: 59  QAVNVRL 65

CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box protein. CSP expression is up-regulated by an abrupt drop in growth temperature. CSP's are also expressed under normal condition at lower level. The function of cold-shock proteins is not fully understood. They preferentially bind poly-pyrimidine region of single-stranded RNA and DNA. CSP's are thought to bind mRNA and regulate ribosomal translation, mRNA degradation, and the rate of transcription termination. The human Y-box protein, which contains a CSD, regulates transcription and translation of genes that contain the Y-box sequence in their promoters. This specific ssDNA-binding properties of CSD are required for the binding of Y-box protein to the promoter's Y-box sequence, thereby regulating transcription. Length = 65
>gnl|CDD|214633 smart00357, CSP, Cold shock protein domain Back     alignment and domain information
>gnl|CDD|224197 COG1278, CspC, Cold shock proteins [Transcription] Back     alignment and domain information
>gnl|CDD|201147 pfam00313, CSD, 'Cold-shock' DNA-binding domain Back     alignment and domain information
>gnl|CDD|170841 PRK10943, PRK10943, cold shock-like protein CspC; Provisional Back     alignment and domain information
>gnl|CDD|182402 PRK10354, PRK10354, RNA chaperone/anti-terminator; Provisional Back     alignment and domain information
>gnl|CDD|131434 TIGR02381, cspD, cold shock domain protein CspD Back     alignment and domain information
>gnl|CDD|169931 PRK09507, cspE, cold shock protein CspE; Reviewed Back     alignment and domain information
>gnl|CDD|77467 PRK09890, PRK09890, cold shock protein CspG; Provisional Back     alignment and domain information
>gnl|CDD|184960 PRK14998, PRK14998, cold shock-like protein CspD; Provisional Back     alignment and domain information
>gnl|CDD|77494 PRK09937, PRK09937, stationary phase/starvation inducible regulatory protein CspD; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
COG127867 CspC Cold shock proteins [Transcription] 99.89
PRK1094369 cold shock-like protein CspC; Provisional 99.88
PRK1546470 cold shock-like protein CspH; Provisional 99.88
PRK0993774 stationary phase/starvation inducible regulatory p 99.88
TIGR0238168 cspD cold shock domain protein CspD. This model re 99.88
PRK1035470 RNA chaperone/anti-terminator; Provisional 99.88
PRK0950769 cspE cold shock protein CspE; Reviewed 99.87
PRK1546370 cold shock-like protein CspF; Provisional 99.87
PRK1499873 cold shock-like protein CspD; Provisional 99.87
PRK0989070 cold shock protein CspG; Provisional 99.86
PF0031366 CSD: 'Cold-shock' DNA-binding domain; InterPro: IP 99.85
cd0445865 CSP_CDS Cold-Shock Protein (CSP) contains an S1-li 99.82
KOG3070|consensus235 99.52
smart0035764 CSP Cold shock protein domain. RNA-binding domain 99.08
PF0820658 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013 97.98
PF1444458 S1-like: S1-like 97.87
PF0749778 Rho_RNA_bind: Rho termination factor, RNA-binding 96.57
PRK11642 813 exoribonuclease R; Provisional 96.16
TIGR00358 654 3_prime_RNase VacB and RNase II family 3'-5' exori 95.92
cd0445968 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CS 95.81
PRK05054 644 exoribonuclease II; Provisional 95.55
PF0057574 S1: S1 RNA binding domain; InterPro: IPR003029 Rib 95.54
TIGR02062 639 RNase_B exoribonuclease II. This family consists o 95.4
cd0446183 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp 95.29
cd0569671 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t 95.26
cd0569870 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp 95.22
cd0445388 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik 94.96
smart0031672 S1 Ribosomal protein S1-like RNA-binding domain. 94.92
TIGR02063 709 RNase_R ribonuclease R. This family consists of an 94.82
cd0570673 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a 94.69
cd0569474 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp 94.61
cd0569269 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p 94.5
cd0446567 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib 94.3
PRK08582139 hypothetical protein; Provisional 94.3
PF1350961 S1_2: S1 domain; PDB: 3GO5_A. 94.16
cd0570768 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a 93.96
cd0570574 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a 93.91
cd0569769 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t 93.89
cd0569173 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p 93.81
cd0568972 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p 93.75
cd0447268 S1_PNPase S1_PNPase: Polynucleotide phosphorylase 93.38
cd0570373 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R 93.36
cd0016465 S1_like S1_like: Ribosomal protein S1-like RNA-bin 93.09
cd0568479 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal 93.09
cd0568673 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom 93.09
cd0569069 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p 92.96
cd0568568 S1_Tex S1_Tex: The C-terminal S1 domain of a trans 92.43
cd0570472 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a 92.39
cd0445276 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr 92.03
PRK05807136 hypothetical protein; Provisional 92.01
PRK07252120 hypothetical protein; Provisional 91.87
COG1098129 VacB Predicted RNA binding protein (contains ribos 91.86
cd0445567 S1_NusA S1_NusA: N-utilizing substance A protein ( 91.55
cd0447377 S1_RecJ_like S1_RecJ_like: The S1 domain of the ar 90.88
cd0569566 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t 90.63
cd0568770 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib 90.55
PRK08059123 general stress protein 13; Validated 90.21
PRK09376 416 rho transcription termination factor Rho; Provisio 90.11
PHA0294588 interferon resistance protein; Provisional 88.74
cd0447183 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai 88.27
cd0578986 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. 88.03
PRK09202 470 nusA transcription elongation factor NusA; Validat 87.64
COG1158 422 Rho Transcription termination factor [Transcriptio 87.57
cd0570270 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R 87.5
PTZ00248 319 eukaryotic translation initiation factor 2 subunit 87.42
cd0570877 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a 86.7
PRK07899 486 rpsA 30S ribosomal protein S1; Reviewed 86.15
cd0568868 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p 85.63
PRK12608 380 transcription termination factor Rho; Provisional 85.62
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 85.24
PRK13806 491 rpsA 30S ribosomal protein S1; Provisional 85.09
PRK13806 491 rpsA 30S ribosomal protein S1; Provisional 84.35
PRK07899 486 rpsA 30S ribosomal protein S1; Reviewed 82.86
TIGR00757 414 RNaseEG ribonuclease, Rne/Rng family. The C-termin 82.78
PRK07400318 30S ribosomal protein S1; Reviewed 82.37
TIGR00767 415 rho transcription termination factor Rho. Members 80.05
>COG1278 CspC Cold shock proteins [Transcription] Back     alignment and domain information 
Probab=99.89  E-value=2.8e-23  Score=139.82  Aligned_cols=65  Identities=35%  Similarity=0.592  Sum_probs=59.3

Q ss_pred             eeeeEEEEeeCCCceeEEecCCCCCeEEEEEccccCC-C-cCCCCCEEEEEEEecCCCCCCceEEEEEec
Q psy3654          58 VETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGC-Y-VPLPGDEVKYRLCPIPPKFEKNQAVHVEIV  125 (140)
Q Consensus        58 ~~~G~VK~f~~~KGfGFI~~~~g~~dIFfH~s~l~~~-~-~~l~Gd~V~F~v~~~~k~~~g~~A~~V~~~  125 (140)
                      +.+|+|||||..||||||++++|++|||||+|+|+.. + .+.+||+|+|++..++   +|++|.||+++
T Consensus         1 ~~~GtVKwfn~~KGfGFI~p~~G~~DvFVH~Sai~~~g~~~L~eGQ~V~f~~~~g~---kgp~A~nv~~~   67 (67)
T COG1278           1 MATGTVKWFNATKGFGFITPEDGGKDVFVHISAIQRAGFRTLREGQKVEFEVEQGR---KGPSAANVRAL   67 (67)
T ss_pred             CCcceEEEeeCCCcceEcCCCCCCcCEEEEeeeeccCCCcccCCCCEEEEEEecCC---CCCceeEEEeC
Confidence            4679999999999999999999999999999999876 4 5669999999999998   59999999864

>PRK10943 cold shock-like protein CspC; Provisional Back     alignment and domain information
>PRK15464 cold shock-like protein CspH; Provisional Back     alignment and domain information
>PRK09937 stationary phase/starvation inducible regulatory protein CspD; Provisional Back     alignment and domain information
>TIGR02381 cspD cold shock domain protein CspD Back     alignment and domain information
>PRK10354 RNA chaperone/anti-terminator; Provisional Back     alignment and domain information
>PRK09507 cspE cold shock protein CspE; Reviewed Back     alignment and domain information
>PRK15463 cold shock-like protein CspF; Provisional Back     alignment and domain information
>PRK14998 cold shock-like protein CspD; Provisional Back     alignment and domain information
>PRK09890 cold shock protein CspG; Provisional Back     alignment and domain information
>PF00313 CSD: 'Cold-shock' DNA-binding domain; InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate [] Back     alignment and domain information
>cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea Back     alignment and domain information
>KOG3070|consensus Back     alignment and domain information
>smart00357 CSP Cold shock protein domain Back     alignment and domain information
>PF08206 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies Back     alignment and domain information
>PF14444 S1-like: S1-like Back     alignment and domain information
>PF07497 Rho_RNA_bind: Rho termination factor, RNA-binding domain; InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts Back     alignment and domain information
>PRK11642 exoribonuclease R; Provisional Back     alignment and domain information
>TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases Back     alignment and domain information
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD) Back     alignment and domain information
>PRK05054 exoribonuclease II; Provisional Back     alignment and domain information
>PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02062 RNase_B exoribonuclease II Back     alignment and domain information
>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains Back     alignment and domain information
>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain Back     alignment and domain information
>smart00316 S1 Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>TIGR02063 RNase_R ribonuclease R Back     alignment and domain information
>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK08582 hypothetical protein; Provisional Back     alignment and domain information
>PF13509 S1_2: S1 domain; PDB: 3GO5_A Back     alignment and domain information
>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain Back     alignment and domain information
>cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide Back     alignment and domain information
>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain Back     alignment and domain information
>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa Back     alignment and domain information
>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain Back     alignment and domain information
>PRK05807 hypothetical protein; Provisional Back     alignment and domain information
>PRK07252 hypothetical protein; Provisional Back     alignment and domain information
>COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain Back     alignment and domain information
>cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease Back     alignment and domain information
>cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK08059 general stress protein 13; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PHA02945 interferon resistance protein; Provisional Back     alignment and domain information
>cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain Back     alignment and domain information
>cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>PRK13806 rpsA 30S ribosomal protein S1; Provisional Back     alignment and domain information
>PRK13806 rpsA 30S ribosomal protein S1; Provisional Back     alignment and domain information
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>TIGR00757 RNaseEG ribonuclease, Rne/Rng family Back     alignment and domain information
>PRK07400 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
3aqq_A147 Crystal Structure Of Human Crhsp-24 Length = 147 1e-29
2bh8_A101 Combinatorial Protein 1b11 Length = 101 4e-05
3i2z_B71 Structure Of Cold Shock Protein E From Salmonella T 1e-04
2l15_A70 Solution Structure Of Cold Shock Protein Cspa Using 2e-04
1mjc_A69 Crystal Structure Of Cspa, The Major Cold Shock Pro 2e-04
3mef_A69 Major Cold-Shock Protein From Escherichia Coli Solu 2e-04
3cam_A67 Crystal Structure Of The Cold Shock Domain Protein 4e-04
>pdb|3AQQ|A Chain A, Crystal Structure Of Human Crhsp-24 Length = 147 Back     alignment and structure 
Iteration: 1

 Score =  124 bits (312), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 72/102 (70%), Gaps = 1/102 (0%)
Query: 35  LPSPIITRRTRTESISNRALQNPVETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGC 94
           +PSP+ TRRTRT S + RA Q PV  G  K FCRSKGHGFITP  G P +F+HISD+EG 
Sbjct: 39  VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGE 98
Query: 95  YVPLPGDEVKYRLCPIPPKFEKNQAVHVEIVHLTPEV-HLQW 135
           YVP+ GDEV Y++C IPPK EK QAV V I HL P   H  W
Sbjct: 99  YVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETW 140
>pdb|2BH8|A Chain A, Combinatorial Protein 1b11 Length = 101 Back     alignment and structure
>pdb|3I2Z|B Chain B, Structure Of Cold Shock Protein E From Salmonella Typhimurium Length = 71 Back     alignment and structure
>pdb|2L15|A Chain A, Solution Structure Of Cold Shock Protein Cspa Using Combined Nmr And Cs-Rosetta Method Length = 70 Back     alignment and structure
>pdb|1MJC|A Chain A, Crystal Structure Of Cspa, The Major Cold Shock Protein Of Escherichia Coli Length = 69 Back     alignment and structure
>pdb|3MEF|A Chain A, Major Cold-Shock Protein From Escherichia Coli Solution Nmr Structure Length = 69 Back     alignment and structure
>pdb|3CAM|A Chain A, Crystal Structure Of The Cold Shock Domain Protein From Neisseria Meningitidis Length = 67 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
3aqq_A147 Calcium-regulated heat stable protein 1; compact b 3e-38
2k5n_A74 Putative cold-shock protein; GFT protein structure 2e-14
2lss_A70 Cold shock-like protein; CSD, CSP, oligonucleotide 7e-12
3cam_A67 Cold-shock domain family protein; cold shock prote 3e-10
3i2z_B71 RNA chaperone, negative regulator of CSPA transcri 3e-10
1h95_A79 CSD, Y-box binding protein; translation factor, tr 7e-09
1c9o_A66 CSPB, cold-shock protein; beta barrel, homodimer, 1e-08
2yty_A88 Cold shock domain-containing protein E1; cell-free 2e-08
1g6p_A66 Cold shock protein TMCSP; greek-KEY, beta barrel, 2e-08
2ytx_A97 Cold shock domain-containing protein E1; cell-free 2e-08
2bh8_A101 1B11; transcription, molecular evolution, unique a 3e-08
3a0j_A73 Cold shock protein; OB-fold, cytoplasm, transcript 3e-08
2kcm_A74 Cold shock domain family protein; nucleic acid bin 2e-07
1x65_A89 UNR protein; cell-free protein synthesis, beta-bar 2e-07
1wfq_A89 UNR protein; beta-barrel, translational regulation 1e-06
3ulj_A90 LIN28B, DNA-binding protein; beta barrel, cold sho 2e-05
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 1e-04
>3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Length = 147 Back     alignment and structure
 Score =  125 bits (316), Expect = 3e-38
 Identities = 66/135 (48%), Positives = 78/135 (57%), Gaps = 1/135 (0%)

Query: 4   SPLPFENKKPALSSPMLSPQEPHLHSNNTLSLPSPIITRRTRTESISNRALQNPVETGKI 63
            P P  ++           +E          +PSP+ TRRTRT S + RA Q PV  G  
Sbjct: 8   PPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVC 67

Query: 64  KEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLCPIPPKFEKNQAVHVE 123
           K FCRSKGHGFITP  G P +F+HISD+EG YVP+ GDEV Y++C IPPK EK QAV V 
Sbjct: 68  KCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVV 127

Query: 124 IVHLTPEV-HLQWDS 137
           I HL P   H  W  
Sbjct: 128 ITHLAPGTKHETWSG 142
>2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} Length = 74 Back     alignment and structure
>2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} Length = 70 Back     alignment and structure
>3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Length = 67 Back     alignment and structure
>3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} PDB: 2l15_A 1mjc_A 3mef_A Length = 71 Back     alignment and structure
>1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 79 Back     alignment and structure
>1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X Length = 66 Back     alignment and structure
>2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 Length = 66 Back     alignment and structure
>2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Length = 101 Back     alignment and structure
>3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Length = 73 Back     alignment and structure
>2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} Length = 74 Back     alignment and structure
>1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 89 Back     alignment and structure
>3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A Length = 90 Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
3aqq_A147 Calcium-regulated heat stable protein 1; compact b 100.0
3cam_A67 Cold-shock domain family protein; cold shock prote 99.9
1x65_A89 UNR protein; cell-free protein synthesis, beta-bar 99.89
3a0j_A73 Cold shock protein; OB-fold, cytoplasm, transcript 99.89
3i2z_B71 RNA chaperone, negative regulator of CSPA transcri 99.89
1c9o_A66 CSPB, cold-shock protein; beta barrel, homodimer, 99.88
2ytx_A97 Cold shock domain-containing protein E1; cell-free 99.88
2k5n_A74 Putative cold-shock protein; GFT protein structure 99.87
3ulj_A90 LIN28B, DNA-binding protein; beta barrel, cold sho 99.87
2kcm_A74 Cold shock domain family protein; nucleic acid bin 99.86
1g6p_A66 Cold shock protein TMCSP; greek-KEY, beta barrel, 99.86
1h95_A79 CSD, Y-box binding protein; translation factor, tr 99.86
1wfq_A89 UNR protein; beta-barrel, translational regulation 99.86
2lss_A70 Cold shock-like protein; CSD, CSP, oligonucleotide 99.76
2yty_A88 Cold shock domain-containing protein E1; cell-free 99.84
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 99.8
2ytv_A79 Cold shock domain-containing protein E1; cell-free 99.76
2bh8_A101 1B11; transcription, molecular evolution, unique a 99.61
1a62_A130 RHO; transcription termination, termination, RNA b 97.08
2id0_A 644 Exoribonuclease 2; RNAse, exonuclease, hydrolyase, 96.13
2k52_A80 Uncharacterized protein MJ1198; metal-binding, zin 95.66
2cqo_A119 Nucleolar protein of 40 kDa; S1 domain, OB-fold, s 95.45
2khi_A115 30S ribosomal protein S1; acetylation, phosphoprot 94.31
2b8k_G215 B16, DNA-directed RNA polymerase II 19 kDa polypep 94.09
3go5_A 285 Multidomain protein with S1 RNA-binding domains; s 93.6
1wi5_A119 RRP5 protein homolog; S1 domain, OB-fold, structur 93.27
2eqs_A103 ATP-dependent RNA helicase DHX8; S1 domain, OB-fol 93.21
1y14_B171 B16, RPB7, DNA-directed RNA polymerase II 19 kDa p 93.18
2k4k_A130 GSP13, general stress protein 13; cytoplasm, stres 93.1
1luz_A88 Protein K3, protein K2; stranded anti-parallel bet 92.06
2khj_A109 30S ribosomal protein S1; OB fold, acetylation, ph 92.01
3aev_A 275 Translation initiation factor 2 subunit alpha; pro 91.88
3h0g_G172 DNA-directed RNA polymerase II subunit RPB7; trans 91.71
4ayb_E180 DNA-directed RNA polymerase; transferase, multi-su 91.66
2bx2_L 517 Ribonuclease E, RNAse E; RNA-binding, RNA turnover 90.76
1go3_E187 DNA-directed RNA polymerase subunit E; transferase 89.95
2c35_B172 Human RPB7, DNA-directed RNA polymerase II 19 kDa 89.7
3l0o_A 427 Transcription termination factor RHO; helicase, RH 89.69
3go5_A285 Multidomain protein with S1 RNA-binding domains; s 89.37
2a19_A175 EIF-2- alpha, eukaryotic translation initiation fa 88.24
1kl9_A182 Eukaryotic translation initiation factor 2 subuni; 87.05
1q8k_A 308 Eukaryotic translation initiation factor 2 subunit 86.44
2vnu_D 760 Exosome complex exonuclease RRP44; hydrolase-RNA c 85.83
3ice_A 422 Transcription termination factor RHO; transcriptio 84.67
2l55_A82 SILB,silver efflux protein, MFP component of the c 83.97
2wp8_J 977 Exosome complex exonuclease DIS3; nucleus, hydrola 82.5
2qcp_X80 Cation efflux system protein CUSF; silver-binding, 80.84
3cw2_C 266 Translation initiation factor 2 subunit alpha; AIF 80.37
2vb2_X88 Copper protein, cation efflux system protein CUSF; 80.31
>3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.4e-35  Score=223.67  Aligned_cols=110  Identities=57%  Similarity=0.928  Sum_probs=92.1

Q ss_pred             CCCCcCCCCcccccccccccccccccCCceeeeEEEEeeCCCceeEEecCCCCCeEEEEEccccCCCcCCCCCEEEEEEE
Q psy3654          29 SNNTLSLPSPIITRRTRTESISNRALQNPVETGKIKEFCRSKGHGFITPDSGEPAVFVHISDIEGCYVPLPGDEVKYRLC  108 (140)
Q Consensus        29 ~~s~~~iPsplp~~r~rt~s~~~~~~~g~~~~G~VK~f~~~KGfGFI~~~~g~~dIFfH~s~l~~~~~~l~Gd~V~F~v~  108 (140)
                      |.++++||++++++|+|+.++++++..+.|.+|+|||||.+||||||+++++++|||||+++|.+.+.+.+||+|+|+++
T Consensus        33 p~~g~liP~~~~trr~r~~s~~~~~~~g~m~~GtVKwFn~~KGfGFI~~ddGg~DVFVH~Sai~~~~~L~eGq~V~Fev~  112 (147)
T 3aqq_A           33 PLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMC  112 (147)
T ss_dssp             --------CCCCCTTSSCHHHHHHHHHSCCEEEEEEEEETTTTEEEEEESSSCSCEEEEGGGEESSBCCCTTCEEEEEEE
T ss_pred             CccccccCCccccccccccccccccccCCccceEEEEEeCCCCeEEeccCCCCccEEEEeeeecCCCcCCCCCEEEEEEE
Confidence            45589999999999999999988999999999999999999999999999999999999999997766779999999999


Q ss_pred             ecCCCCCCceEEEEEecCCCCc-cccccCCC
Q psy3654         109 PIPPKFEKNQAVHVEIVHLTPE-VHLQWDSP  138 (140)
Q Consensus       109 ~~~k~~~g~~A~~V~~~~~~p~-~~~~w~~~  138 (140)
                      .++++.+|++|++|++++.+|+ +|++|+++
T Consensus       113 ~~~~~~~g~qA~nV~~~~~~p~~~h~~~~~~  143 (147)
T 3aqq_A          113 SIPPKNEKLQAVEVVITHLAPGTKHETWSGH  143 (147)
T ss_dssp             EC--CCSCEEEEEEEEEECCSSSCCCBCC--
T ss_pred             eccCCCCCceEEEEEeCCCCCCccccccccc
Confidence            8654457899999999999995 99999986
>3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Back     alignment and structure
>1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} Back     alignment and structure
>3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Back     alignment and structure
>3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} SCOP: b.40.4.5 PDB: 2l15_A 1mjc_A 3mef_A Back     alignment and structure
>1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X Back     alignment and structure
>2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} Back     alignment and structure
>3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A Back     alignment and structure
>2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} Back     alignment and structure
>1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 Back     alignment and structure
>1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} Back     alignment and structure
>2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>2ytv_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Back     alignment and structure
>1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A Back     alignment and structure
>2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Back     alignment and structure
>2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Back     alignment and structure
>2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... Back     alignment and structure
>2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Back     alignment and structure
>1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 Back     alignment and structure
>2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Back     alignment and structure
>3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Back     alignment and structure
>2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A Back     alignment and structure
>1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Back     alignment and structure
>1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Back     alignment and structure
>1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Back     alignment and structure
>2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2l55_A SILB,silver efflux protein, MFP component of the components proton antiporter metal...; APO form, AG(I)-binding site; NMR {Cupriavidus metallidurans} Back     alignment and structure
>2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2qcp_X Cation efflux system protein CUSF; silver-binding, copper-binding, beta barrel, OB-fold, metall metal resistance, metal-binding; 1.00A {Escherichia coli str} PDB: 1zeq_X 3e6z_X Back     alignment and structure
>3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Back     alignment and structure
>2vb2_X Copper protein, cation efflux system protein CUSF; cation PI, metal-binding, metal transport, copper tolerance, transport; 1.70A {Escherichia coli} PDB: 2vb3_X Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1g6pa_66 b.40.4.5 (A:) Major cold shock protein {Thermotoga 2e-13
d1mjca_69 b.40.4.5 (A:) Major cold shock protein {Escherichi 2e-13
d1h95a_79 b.40.4.5 (A:) Y-box protein 1 cold shock domain (Y 1e-12
d1wfqa_89 b.40.4.5 (A:) Cold shock domain protein E1 (UNR) { 1e-11
d1c9oa_66 b.40.4.5 (A:) Major cold shock protein {Bacillus c 7e-11
>d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Length = 66 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Major cold shock protein
species: Thermotoga maritima [TaxId: 2336]

 Score = 59.0 bits (143), Expect = 2e-13
 Identities = 27/68 (39%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 60  TGKIKEFCRSKGHGFITPDSGEPAVFVHISDI--EGCYVPLPGDEVKYRLCPIPPKFEKN 117
            GK+K F   KG+GFIT D G   VFVH S I  EG      G  V++ +       +  
Sbjct: 2   RGKVKWFDSKKGYGFITKDEGGD-VFVHWSAIEMEGFKTLKEGQVVEFEIQEGK---KGP 57

Query: 118 QAVHVEIV 125
           QA HV++V
Sbjct: 58  QAAHVKVV 65
>d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Length = 69 Back     information, alignment and structure
>d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Length = 66 Back     information, alignment and structure