Diaphorina citri psyllid: psy3658


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MSKALSTSAKRIQKELAEITLDPPPNYVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGV
cHHHHHHHHHHHHHHHcccccccccccCEEEEECccCEEEEEccccccHHHHHHHHHHHccccCCccccEEEcc
*********KRIQKELA*ITLDPPPNYVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKALSTSAKRIQKELAEITLDPPPNYVLLENWNPLGVVGIISAFNFPVAVYGWNAAIALPGWQVLGQVALVGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-aminoadipic semialdehyde dehydrogenase Multifunctional enzyme mediating important protective effects. Metabolizes betaine aldehyde to betaine, an important cellular osmolyte and methyl donor. Protects cells from oxidative stress by metabolizing a number of lipid peroxidation-derived aldehydes. Involved in lysine catabolism.confidentQ2KJC9
Putative aldehyde dehydrogenase family 7 member A1 homolog confidentP46562
Aldehyde dehydrogenase family 7 member B4 confidentQ9SYG7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0004029 [MF]aldehyde dehydrogenase (NAD) activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0004043 [MF]L-aminoadipate-semialdehyde dehydrogenase activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0009269 [BP]response to desiccationprobableGO:1901700, GO:0009628, GO:0050896, GO:0006950, GO:0008150, GO:0009414, GO:0009415, GO:0042221, GO:0010035
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006081 [BP]cellular aldehyde metabolic processprobableGO:0044710, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0044699 [BP]single-organism processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J6L, chain A
Confidence level:very confident
Coverage over the Query: 3-68
View the alignment between query and template
View the model in PyMOL