Diaphorina citri psyllid: psy3671


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
LAEIGKLDTPKVQGKYSTGQLFLHRVFGYRGIVLFPWLARVYDRDIPNKRDKPSDVNGSVGKEVKSKTHTFYQVLIDSRDCPYIRAQTEAVTFLGNQNSNKSLYAIPGLDYVAHEDILPYSCSHEQPLHHELFDKFLVHMPDKDPPFVAQQTLRTWQRKNHPWLELSDVHKETTENVRVTVIPFYMGCRDSPTSSVYWWRYCIRLENLGELTVQLRERHWRIFSLSGTLETVRGRGVVGQEPVLSKSLPAFQYSSHVSLQAPSGHM
cccccccccccccccccccHHHHHHHccccEEEEcCECcEEEEcccccccccccccccccccccccCEEEEEEEEEcccccccccccccEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccHHHHHHHccccccccccHHccccccEEEEEcEECccccccccccEEEEEEEEEEEcccccEEEEEEEEEEEEccccEEEEEcccccccccCECcccccEEEECcCECccccccc
*AEIGK*DTP****KYSTGQLFLHRVFGYRGIVLFPWLARVYDRDI*********************THTFYQVLIDSRDCPYIRAQTEAVTFLGNQNSNKSLYAIPGLDYVAHEDILPYSCSHEQPLHHELFDKFLVHMPDKDPPFVAQQTLRTWQRKNHPWLELSDVHKETTENVRVTVIPFYMGCRDSPTSSVYWWRYCIRLENLGELTVQLRERHWRIFSLSGTLETVRGRGVVGQEPVLSKSLPAFQYSSHVSLQAPSG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LAEIGKLDTPKVQGKYSTGQLFLHRVFGYRGIVLFPWLARVYDRDIPNKRDKPSDVNGSVGKEVKSKTHTFYQVLIDSRDCPYIRAQTEAVTFLGNQNSNKSLYAIPGLDYVAHEDILPYSCSHEQPLHHELFDKFLVHMPDKDPPFVAQQTLRTWQRKNHPWLELSDVHKETTENVRVTVIPFYMGCRDSPTSSVYWWRYCIRLENLGELTVQLRERHWRIFSLSGTLETVRGRGVVGQEPVLSKSLPAFQYSSHVSLQAPSGHM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polymerase delta-interacting protein 2 very confidentQ91VA6
Polymerase delta-interacting protein 2 confidentQ9Y2S7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042645 [CC]mitochondrial nucleoidconfidentGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0070584 [BP]mitochondrion morphogenesisprobableGO:0006996, GO:0032502, GO:0009987, GO:0032990, GO:0048869, GO:0071840, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0044699, GO:0008150, GO:0009653, GO:0007005
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043009 [BP]chordate embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0030674 [MF]protein binding, bridgingprobableGO:0003674, GO:0005488, GO:0005515, GO:0060090

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F1E, chain A
Confidence level:very confident
Coverage over the Query: 174-266
View the alignment between query and template
View the model in PyMOL
Template: 1VBV, chain A
Confidence level:confident
Coverage over the Query: 13-47,68-91,109-145
View the alignment between query and template
View the model in PyMOL