Diaphorina citri psyllid: psy3672


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
LFLYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFIMHV
cccccEEEEEcccEEEEEEEccHHccccHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHccccccccCEEcccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccc
LFLYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFIMHV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LFLYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFIMHV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial confidentP70404
Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial confidentQ58CP0
Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial confidentP41565

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X0L, chain A
Confidence level:very confident
Coverage over the Query: 3-82,105-164
View the alignment between query and template
View the model in PyMOL
Template: 1HQS, chain A
Confidence level:very confident
Coverage over the Query: 12-164
View the alignment between query and template
View the model in PyMOL