Psyllid ID: psy3672

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
LFLYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFIMHV
cccccEEEEEcccEEEEEEEccHHccccHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
cEEEEEEEcccccEEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHccccEEccccccccHHcccccccccEEEEcEEEcHHHHHHHccccccEEEEccccccHHHHccccccccccccccccccEEEEcccccccccccccccccHHHHHcc
LFLYLLDRLRQLSVCDKVSLRyeetidpcprfsYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLypvwtnrkmITGFIWTTRDINVFIWTIRRIITVFNWtrqivsnphqfdvmvmpnlygniFDVMVMpnlygnivdnlasdsvisrtgscqqscdMVSEFACSKFIMHV
LFLYLldrlrqlsvcdkvslryeetidpcprfSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFIMHV
lflylldrlrqlSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFIMHV
*FLYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFI***
LFLYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFIMHV
LFLYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVI**********DMVSEFACSKFIMHV
LFLYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFIMHV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LFLYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQSCDMVSEFACSKFIMHV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
P41564355 Isocitrate dehydrogenase N/A N/A 0.432 0.216 0.524 5e-19
P51553393 Isocitrate dehydrogenase yes N/A 0.432 0.195 0.524 5e-19
Q93353379 Probable isocitrate dehyd yes N/A 0.674 0.316 0.408 5e-19
Q58CP0392 Isocitrate dehydrogenase yes N/A 0.432 0.196 0.524 5e-19
P41565393 Isocitrate dehydrogenase yes N/A 0.432 0.195 0.524 1e-18
P70404393 Isocitrate dehydrogenase yes N/A 0.432 0.195 0.524 1e-18
O77784385 Isocitrate dehydrogenase no N/A 0.595 0.275 0.404 2e-18
Q8LFC0367 Isocitrate dehydrogenase yes N/A 0.438 0.212 0.48 5e-18
Q68FX0385 Isocitrate dehydrogenase no N/A 0.595 0.275 0.396 1e-17
O43837385 Isocitrate dehydrogenase no N/A 0.595 0.275 0.396 1e-17
>sp|P41564|IDH3G_MACFA Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (Fragment) OS=Macaca fascicularis GN=IDH3G PE=2 SV=1 Back     alignment and function desciption
 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 58/101 (57%), Gaps = 24/101 (23%)

Query: 32  FSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDI 91
           F   Q+  S RKKVTAVHKANIMKLGDGLFL  C+E+A  YP  T   MI          
Sbjct: 167 FKLAQE--SGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMI---------- 214

Query: 92  NVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFD 132
                       V N T Q+VS P QFDVMVMPNLYGNI +
Sbjct: 215 ------------VDNTTMQLVSRPQQFDVMVMPNLYGNIVN 243

Macaca fascicularis (taxid: 9541)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 1
>sp|P51553|IDH3G_HUMAN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens GN=IDH3G PE=1 SV=1 Back     alignment and function description
>sp|Q93353|IDH3B_CAEEL Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=C37E2.1 PE=3 SV=1 Back     alignment and function description
>sp|Q58CP0|IDH3G_BOVIN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Bos taurus GN=IDH3G PE=2 SV=1 Back     alignment and function description
>sp|P41565|IDHG1_RAT Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus GN=Idh3g PE=2 SV=2 Back     alignment and function description
>sp|P70404|IDHG1_MOUSE Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus GN=Idh3g PE=1 SV=1 Back     alignment and function description
>sp|O77784|IDH3B_BOVIN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Bos taurus GN=IDH3B PE=2 SV=2 Back     alignment and function description
>sp|Q8LFC0|IDH1_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana GN=IDH1 PE=1 SV=2 Back     alignment and function description
>sp|Q68FX0|IDH3B_RAT Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Rattus norvegicus GN=Idh3B PE=1 SV=1 Back     alignment and function description
>sp|O43837|IDH3B_HUMAN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens GN=IDH3B PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
332023734 374 Isocitrate dehydrogenase [NAD] subunit b 0.471 0.224 0.521 2e-21
307166534 374 Probable isocitrate dehydrogenase [NAD] 0.471 0.224 0.512 5e-21
307210578 374 Probable isocitrate dehydrogenase [NAD] 0.471 0.224 0.512 5e-21
322793633 375 hypothetical protein SINV_09716 [Solenop 0.471 0.224 0.512 8e-21
350412918 374 PREDICTED: isocitrate dehydrogenase [NAD 0.449 0.213 0.539 8e-21
340708564 374 PREDICTED: isocitrate dehydrogenase [NAD 0.449 0.213 0.539 8e-21
66530240 374 PREDICTED: isocitrate dehydrogenase [NAD 0.449 0.213 0.539 9e-21
380026705 374 PREDICTED: isocitrate dehydrogenase [NAD 0.449 0.213 0.539 9e-21
383856749 374 PREDICTED: isocitrate dehydrogenase [NAD 0.449 0.213 0.549 9e-21
242017298 390 isocitrate dehydrogenase NAD subunit bet 0.432 0.197 0.554 2e-20
>gi|332023734|gb|EGI63958.1| Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 70/119 (58%), Gaps = 35/119 (29%)

Query: 31  RFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRD 90
           +F++   + +NRKKVT VHKANIMKLGDGLFL SC+E+AKLYP  T   MI         
Sbjct: 192 KFAFDYAVKNNRKKVTCVHKANIMKLGDGLFLKSCQEIAKLYPRITFETMI--------- 242

Query: 91  INVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLAS 149
                        V N T Q+VSNPHQFDVMVMP             NLYGNIVDNLAS
Sbjct: 243 -------------VDNCTMQMVSNPHQFDVMVMP-------------NLYGNIVDNLAS 275

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|307166534|gb|EFN60601.1| Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307210578|gb|EFN87046.1| Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322793633|gb|EFZ17083.1| hypothetical protein SINV_09716 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350412918|ref|XP_003489815.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340708564|ref|XP_003392893.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|66530240|ref|XP_624511.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380026705|ref|XP_003697085.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|383856749|ref|XP_003703870.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242017298|ref|XP_002429128.1| isocitrate dehydrogenase NAD subunit beta, putative [Pediculus humanus corporis] gi|212513995|gb|EEB16390.1| isocitrate dehydrogenase NAD subunit beta, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
FB|FBgn0038922370 CG6439 [Drosophila melanogaste 0.286 0.137 0.607 1.2e-19
UNIPROTKB|E9PF84285 IDH3G "Isocitrate dehydrogenas 0.269 0.168 0.64 1.8e-19
WB|WBGene00007993379 idhb-1 [Caenorhabditis elegans 0.320 0.150 0.525 6.2e-19
ZFIN|ZDB-GENE-040625-174383 idh3b "isocitrate dehydrogenas 0.241 0.112 0.651 1.1e-18
UNIPROTKB|O77784385 IDH3B "Isocitrate dehydrogenas 0.286 0.132 0.588 1.7e-18
UNIPROTKB|I3L8X0312 LOC100624447 "Uncharacterized 0.241 0.137 0.627 1.9e-18
RGD|621881385 Idh3B "isocitrate dehydrogenas 0.241 0.111 0.627 3.7e-18
UNIPROTKB|H9L0K2385 IDH3B "Uncharacterized protein 0.241 0.111 0.627 4.8e-18
UNIPROTKB|F1PTM3383 IDH3B "Uncharacterized protein 0.241 0.112 0.627 6.1e-18
UNIPROTKB|E2QUB9385 IDH3B "Uncharacterized protein 0.241 0.111 0.627 6.2e-18
FB|FBgn0038922 CG6439 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 154 (59.3 bits), Expect = 1.2e-19, Sum P(2) = 1.2e-19
 Identities = 31/51 (60%), Positives = 39/51 (76%)

Query:    31 RFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMI 81
             +F++     + RKKVTAVHKANIMKLGDGLFL SC+E+++LYP     KMI
Sbjct:   188 KFAFDYATKNQRKKVTAVHKANIMKLGDGLFLRSCEEVSRLYPRIQFEKMI 238
GO:0004449 "isocitrate dehydrogenase (NAD+) activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISS
GO:0006099 "tricarboxylic acid cycle" evidence=ISS
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|E9PF84 IDH3G "Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00007993 idhb-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-174 idh3b "isocitrate dehydrogenase 3 (NAD+) beta" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O77784 IDH3B "Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L8X0 LOC100624447 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|621881 Idh3B "isocitrate dehydrogenase 3 (NAD+) beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0K2 IDH3B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTM3 IDH3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUB9 IDH3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58CP0IDH3G_BOVIN1, ., 1, ., 1, ., 4, 10.52470.43250.1964yesN/A
P70404IDHG1_MOUSE1, ., 1, ., 1, ., 4, 10.52470.43250.1959yesN/A
P41565IDHG1_RAT1, ., 1, ., 1, ., 4, 10.52470.43250.1959yesN/A
P51553IDH3G_HUMAN1, ., 1, ., 1, ., 4, 10.52470.43250.1959yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
TIGR00175333 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, 1e-31
PLN00123360 PLN00123, PLN00123, isocitrate dehydrogenase (NAD+ 2e-27
COG0473348 COG0473, LeuB, Isocitrate/isopropylmalate dehydrog 3e-21
PRK08997334 PRK08997, PRK08997, isocitrate dehydrogenase; Prov 4e-20
PLN00118372 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+ 2e-19
PRK09222 482 PRK09222, PRK09222, isocitrate dehydrogenase; Vali 5e-17
TIGR02924 473 TIGR02924, ICDH_alpha, isocitrate dehydrogenase 1e-13
TIGR02088322 TIGR02088, LEU3_arch, isopropylmalate/isohomocitra 9e-12
pfam00180349 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehy 1e-11
PRK14025330 PRK14025, PRK14025, multifunctional 3-isopropylmal 3e-11
PRK00772358 PRK00772, PRK00772, 3-isopropylmalate dehydrogenas 3e-07
COG0538407 COG0538, Icd, Isocitrate dehydrogenases [Energy pr 9e-07
TIGR00183416 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase 1e-06
PRK06451412 PRK06451, PRK06451, isocitrate dehydrogenase; Vali 6e-06
PRK03437344 PRK03437, PRK03437, 3-isopropylmalate dehydrogenas 2e-05
TIGR00169346 TIGR00169, leuB, 3-isopropylmalate dehydrogenase 7e-05
PRK07006409 PRK07006, PRK07006, isocitrate dehydrogenase; Revi 1e-04
>gnl|CDD|232856 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, NAD-dependent, mitochondrial type Back     alignment and domain information 
 Score =  115 bits (290), Expect = 1e-31
 Identities = 51/102 (50%), Positives = 58/102 (56%), Gaps = 22/102 (21%)

Query: 31  RFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRD 90
           R+++     + RKKVTAVHKANIMKL DGLFLN C+E+AK YP  T   MI         
Sbjct: 152 RYAFEYARKNGRKKVTAVHKANIMKLADGLFLNVCREVAKEYPDITFESMI--------- 202

Query: 91  INVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFD 132
                        V N   Q+VS P QFDVMVMPNLYGNI  
Sbjct: 203 -------------VDNTCMQLVSRPSQFDVMVMPNLYGNILS 231

Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the multimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs. These enzymes dehydrogenate their substates at a H-C-OH site adjacent to a H-C-COOH site; the latter carbon, now adjacent to a carbonyl group, readily decarboxylates. Mitochondrial NAD-dependent isocitrate dehydrogenases (IDH) resemble prokaryotic NADP-dependent IDH and 3-isopropylmalate dehydrogenase (an NAD-dependent enzyme) more closely than they resemble eukaryotic NADP-dependent IDH. The mitochondrial NAD-dependent isocitrate dehydrogenase is believed to be an alpha(2)-beta-gamma heterotetramer. All subunits are homologous and found by this model. The NADP-dependent IDH of Thermus aquaticus thermophilus strain HB8 resembles these NAD-dependent IDH, except for the residues involved in cofactor specificity, much more closely than it resembles other prokaryotic NADP-dependent IDH, including that of Thermus aquaticus strain YT1 [Energy metabolism, TCA cycle]. Length = 333
>gnl|CDD|215065 PLN00123, PLN00123, isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>gnl|CDD|223549 COG0473, LeuB, Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181606 PRK08997, PRK08997, isocitrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215062 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>gnl|CDD|236416 PRK09222, PRK09222, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|234062 TIGR02924, ICDH_alpha, isocitrate dehydrogenase Back     alignment and domain information
>gnl|CDD|233717 TIGR02088, LEU3_arch, isopropylmalate/isohomocitrate dehydrogenases Back     alignment and domain information
>gnl|CDD|215773 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|184462 PRK14025, PRK14025, multifunctional 3-isopropylmalate dehydrogenase/D-malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234832 PRK00772, PRK00772, 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223612 COG0538, Icd, Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|232862 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase, NADP-dependent, prokaryotic type Back     alignment and domain information
>gnl|CDD|235803 PRK06451, PRK06451, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|179579 PRK03437, PRK03437, 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|232853 TIGR00169, leuB, 3-isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|180792 PRK07006, PRK07006, isocitrate dehydrogenase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
COG0473348 LeuB Isocitrate/isopropylmalate dehydrogenase [Ami 100.0
PLN00123360 isocitrate dehydrogenase (NAD+) 100.0
PRK08997334 isocitrate dehydrogenase; Provisional 100.0
PRK03437344 3-isopropylmalate dehydrogenase; Provisional 100.0
PRK14025330 multifunctional 3-isopropylmalate dehydrogenase/D- 100.0
PLN00118372 isocitrate dehydrogenase (NAD+) 100.0
PRK09222 482 isocitrate dehydrogenase; Validated 100.0
TIGR02089352 TTC tartrate dehydrogenase. Tartrate dehydrogenase 100.0
TIGR00175333 mito_nad_idh isocitrate dehydrogenase, NAD-depende 100.0
TIGR02924 473 ICDH_alpha isocitrate dehydrogenase. This family o 100.0
PRK08194352 tartrate dehydrogenase; Provisional 100.0
TIGR02088322 LEU3_arch isopropylmalate/isohomocitrate dehydroge 100.0
TIGR00169349 leuB 3-isopropylmalate dehydrogenase. This model w 100.0
PLN02329409 3-isopropylmalate dehydrogenase 100.0
PRK07006409 isocitrate dehydrogenase; Reviewed 100.0
PRK06451412 isocitrate dehydrogenase; Validated 100.0
TIGR00183416 prok_nadp_idh isocitrate dehydrogenase, NADP-depen 100.0
PRK00772358 3-isopropylmalate dehydrogenase; Provisional 100.0
PF00180348 Iso_dh: Isocitrate/isopropylmalate dehydrogenase; 100.0
PRK07362474 isocitrate dehydrogenase; Validated 100.0
KOG0785|consensus365 100.0
PTZ00435413 isocitrate dehydrogenase; Provisional 100.0
TIGR00127409 nadp_idh_euk isocitrate dehydrogenase, NADP-depend 100.0
PRK08299402 isocitrate dehydrogenase; Validated 100.0
KOG0784|consensus375 100.0
PLN00103410 isocitrate dehydrogenase (NADP+); Provisional 100.0
PLN00096393 isocitrate dehydrogenase (NADP+); Provisional 100.0
PLN03065483 isocitrate dehydrogenase (NADP+); Provisional 100.0
COG0538407 Icd Isocitrate dehydrogenases [Energy production a 100.0
KOG0786|consensus363 99.97
KOG1526|consensus422 99.85
>COG0473 LeuB Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-50  Score=356.57  Aligned_cols=137  Identities=31%  Similarity=0.377  Sum_probs=130.5

Q ss_pred             eeecceeccc---ceeeeEEeeecccccHHHHHHHHHHHhCCCCcEEEEeCCCccccccHHHHHHHHHHHhhCCCeEEEE
Q psy3672           3 LYLLDRLRQL---SVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRK   79 (178)
Q Consensus         3 ~~~~~~~~~~---~~~~~~~~~t~~~~eRiar~AFe~A~~~~rk~Vt~vhKaNvlk~tdglf~~i~~eva~eYpdv~~~~   79 (178)
                      +|||.+.+..   ++++++++||++++|||+|+|||+|++|+||+||+|||+|||+.++|+|+++++|++++||+|++++
T Consensus       132 ~Y~G~~~~~~~~~eva~~~~~~Tr~~~eRI~r~AFe~A~~R~~kkvTsv~KaNVl~~s~~lwrev~~eva~~yPdv~~~~  211 (348)
T COG0473         132 LYFGEEGRILGGGEVAIDTKVITRKGSERIARFAFELARKRGRKKVTSVHKANVLKLSDGLWREVVEEVAKEYPDVELDH  211 (348)
T ss_pred             cccCCCccccCCCeEEEEEEeccHHHHHHHHHHHHHHHHhhCCCceEEEehhhhhhhhhHHHHHHHHHHhhcCCCcchhH
Confidence            6999877422   3999999999999999999999999999889999999999999999999999999999999999999


Q ss_pred             EEEeeeeccccccceeEEEeecccccHHHHHHhhCCCCCcEEEeeCCCcccccccccccccccccccCccccccCCC--C
Q psy3672          80 MITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRT--G  157 (178)
Q Consensus        80 ~~v~~~~~~~~~~~~i~~~~~~i~~Da~~~~LV~~P~~fDViv~~Nl~GDILSDlaA~l~GglGl~psa~~~~ig~~--~  157 (178)
                      +++                      |+++||||++|++||||||+|||||||||++|+++||+||+||||   +|+.  +
T Consensus       212 ~~V----------------------D~aam~lV~~P~~FDViVt~NlFGDILSD~aa~l~GslGl~PSAn---ig~~~~~  266 (348)
T COG0473         212 MYV----------------------DAAAMQLVRNPEQFDVIVTSNLFGDILSDEAAALTGSLGLAPSAN---LGDERGP  266 (348)
T ss_pred             HhH----------------------HHHHHHHhhCccccCEEEEccchhHHHHhHHHHhcCccccCccCc---cCCCCCC
Confidence            999                      999999999999999999999999999999999999999999999   6776  9


Q ss_pred             ceecCcc
Q psy3672         158 SCQQSCD  164 (178)
Q Consensus       158 ~~fep~~  164 (178)
                      +||||||
T Consensus       267 ~lfEPvH  273 (348)
T COG0473         267 ALFEPVH  273 (348)
T ss_pred             ceeecCC
Confidence            9999998

>PLN00123 isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>PRK08997 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>PRK03437 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PRK14025 multifunctional 3-isopropylmalate dehydrogenase/D-malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00118 isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>PRK09222 isocitrate dehydrogenase; Validated Back     alignment and domain information
>TIGR02089 TTC tartrate dehydrogenase Back     alignment and domain information
>TIGR00175 mito_nad_idh isocitrate dehydrogenase, NAD-dependent, mitochondrial type Back     alignment and domain information
>TIGR02924 ICDH_alpha isocitrate dehydrogenase Back     alignment and domain information
>PRK08194 tartrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02088 LEU3_arch isopropylmalate/isohomocitrate dehydrogenases Back     alignment and domain information
>TIGR00169 leuB 3-isopropylmalate dehydrogenase Back     alignment and domain information
>PLN02329 3-isopropylmalate dehydrogenase Back     alignment and domain information
>PRK07006 isocitrate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06451 isocitrate dehydrogenase; Validated Back     alignment and domain information
>TIGR00183 prok_nadp_idh isocitrate dehydrogenase, NADP-dependent, prokaryotic type Back     alignment and domain information
>PRK00772 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PF00180 Iso_dh: Isocitrate/isopropylmalate dehydrogenase; InterPro: IPR024084 Isocitrate dehydrogenase (IDH) [, ] is an important enzyme of carbohydrate metabolism which catalyses the oxidative decarboxylation of isocitrate into alpha-ketoglutarate Back     alignment and domain information
>PRK07362 isocitrate dehydrogenase; Validated Back     alignment and domain information
>KOG0785|consensus Back     alignment and domain information
>PTZ00435 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00127 nadp_idh_euk isocitrate dehydrogenase, NADP-dependent, eukaryotic type Back     alignment and domain information
>PRK08299 isocitrate dehydrogenase; Validated Back     alignment and domain information
>KOG0784|consensus Back     alignment and domain information
>PLN00103 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>PLN00096 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>PLN03065 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>COG0538 Icd Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>KOG0786|consensus Back     alignment and domain information
>KOG1526|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
3blw_A349 Yeast Isocitrate Dehydrogenase With Citrate And Amp 4e-14
3blv_A354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 3e-13
1wpw_A336 Crystal Structure Of Ipmdh From Sulfolobus Tokodaii 1e-07
1x0l_A333 Crystal Structure Of Tetrameric Homoisocitrate Dehy 4e-07
3asj_A334 Crystal Structure Of Homoisocitrate Dehydrogenase I 4e-07
3blw_B354 Yeast Isocitrate Dehydrogenase With Citrate And Amp 6e-07
3blv_B354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 7e-07
3ah3_A334 Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehyd 7e-07
3ty3_A366 Crystal Structure Of Homoisocitrate Dehydrogenase F 3e-06
2d1c_A 496 Crystal Structure Of Tt0538 Protein From Thermus Th 6e-06
3u1h_A390 Crystal Structure Of Ipmdh From The Last Common Anc 2e-05
2dht_A409 Crystal Structure Of Isocitrate Dehydrogenase From 7e-05
1w0d_A337 The High Resolution Structure Of Mycobacterium Tube 2e-04
>pdb|3BLW|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 349 Back     alignment and structure 
Iteration: 1

 Score = 73.9 bits (180), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 67/144 (46%), Gaps = 30/144 (20%)
Query: 31  RFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMA-KLYPVWTNRKMITGFIWTTR 89
           RF++      NRK VTAVHKANIMKLGDGLF N   E+  K YP                
Sbjct: 164 RFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYP---------------- 207
Query: 90  DINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFD-----VMVMPNLYGNIV 144
           DI+V        I V N + Q V+ PHQFDV+V P++YG I       ++  P L     
Sbjct: 208 DIDV------SSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGA- 260
Query: 145 DNLASDSVISRTGSCQQSCDMVSE 168
            N   D  +   GS     D+  +
Sbjct: 261 -NFGRDYAVFEPGSRHVGLDIKGQ 283
>pdb|3BLV|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|1WPW|A Chain A, Crystal Structure Of Ipmdh From Sulfolobus Tokodaii Length = 336 Back     alignment and structure
>pdb|1X0L|A Chain A, Crystal Structure Of Tetrameric Homoisocitrate Dehydrogenase From An Extreme Thermophile, Thermus Thermophilus Length = 333 Back     alignment and structure
>pdb|3ASJ|A Chain A, Crystal Structure Of Homoisocitrate Dehydrogenase In Complex With A Designed Inhibitor Length = 334 Back     alignment and structure
>pdb|3BLW|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|3BLV|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|3AH3|A Chain A, Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehydrogenase Created By Directed Evolution Length = 334 Back     alignment and structure
>pdb|3TY3|A Chain A, Crystal Structure Of Homoisocitrate Dehydrogenase From Schizosaccharomyces Pombe Bound To Glycyl-Glycyl-Glycine Length = 366 Back     alignment and structure
>pdb|2D1C|A Chain A, Crystal Structure Of Tt0538 Protein From Thermus Thermophilus Hb8 Length = 496 Back     alignment and structure
>pdb|3U1H|A Chain A, Crystal Structure Of Ipmdh From The Last Common Ancestor Of Bacillus Length = 390 Back     alignment and structure
>pdb|2DHT|A Chain A, Crystal Structure Of Isocitrate Dehydrogenase From Sulfolobus Tokodaii Strain7 Length = 409 Back     alignment and structure
>pdb|1W0D|A Chain A, The High Resolution Structure Of Mycobacterium Tuberculosis Leub (Rv2995c) Length = 337 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPP 2e-29
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycl 3e-29
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycl 1e-27
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, deca 5e-26
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2 1e-25
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarbo 2e-24
3dms_A427 Isocitrate dehydrogenase [NADP]; struc genomics, s 6e-24
1tyo_A435 Isocitrate dehydrogenase; enzyme-ethenonadp comple 7e-24
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate 8e-23
3ty4_A366 Probable homoisocitrate dehydrogenase; B-hydroxyac 1e-21
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh 1e-21
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, 3e-17
3flk_A364 Tartrate dehydrogenase/decarboxylase; cytoplasm, l 6e-13
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, l 6e-09
3u1h_A390 3-isopropylmalate dehydrogenase; oxidored; 2.80A { 6e-07
3udu_A361 3-isopropylmalate dehydrogenase; structural genomi 7e-07
3r8w_A405 3-isopropylmalate dehydrogenase 2, chloroplastic; 1e-06
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxid 1e-06
2y3z_A359 3-isopropylmalate dehydrogenase; oxidoreductase, L 1e-06
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structura 1e-06
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogen 1e-06
3vmk_A375 3-isopropylmalate dehydrogenase; oxidoreductase, d 1e-06
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus} Length = 496 Back     alignment and structure
 Score =  111 bits (279), Expect = 2e-29
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 24/99 (24%)

Query: 32  FSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDI 91
           F   +     RKKV    K+NIMKL +G    + +++A+ YP      +I          
Sbjct: 175 FELARA--EGRKKVHCATKSNIMKLAEGTLKRAFEQVAQEYPDIEAVHII---------- 222

Query: 92  NVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNI 130
                       V N   Q+V  P QF+V+V  N+ G+I
Sbjct: 223 ------------VDNAAHQLVKRPEQFEVIVTTNMNGDI 249
>3blx_B Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_B* 3blv_B Length = 354 Back     alignment and structure
>3blx_A Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_A 3blv_A* Length = 349 Back     alignment and structure
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosyn; 1.85A {Thermus thermophilus} PDB: 3asj_A* 3ah3_A Length = 333 Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Length = 336 Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Length = 412 Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; struc genomics, seattle structural genomics center for infectious ssgcid, glyoxylate bypass, manganese; 1.65A {Burkholderia pseudomallei} PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 3lcb_C* 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A 8icd_A* 6icd_A ... Length = 427 Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Length = 435 Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Length = 409 Back     alignment and structure
>3ty4_A Probable homoisocitrate dehydrogenase; B-hydroxyacid oxidative decarboxylase, amino-acid biosynthes lysine biosynthesis; 1.55A {Schizosaccharomyces pombe} PDB: 3ty3_A Length = 366 Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Length = 423 Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Length = 429 Back     alignment and structure
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Length = 364 Back     alignment and structure
>1w0d_A 3-isopropylmalate dehydrogenase; oxidoreductase, leucine biosynthesis, NAD, ST genomics, PSI, protein structure initiative; 1.65A {Mycobacterium tuberculosis} SCOP: c.77.1.1 PDB: 2g4o_A Length = 337 Back     alignment and structure
>3u1h_A 3-isopropylmalate dehydrogenase; oxidored; 2.80A {Bacillus SP} PDB: 2ayq_A 1v53_A 1v5b_A Length = 390 Back     alignment and structure
>3udu_A 3-isopropylmalate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.85A {Campylobacter jejuni} PDB: 3udo_A Length = 361 Back     alignment and structure
>3r8w_A 3-isopropylmalate dehydrogenase 2, chloroplastic; dimer, isocitrate and isopropylmalate dehydrogenases family, biosynthesis; 2.25A {Arabidopsis thaliana} Length = 405 Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Acidithiobacillus ferrooxidans} SCOP: c.77.1.1 Length = 358 Back     alignment and structure
>2y3z_A 3-isopropylmalate dehydrogenase; oxidoreductase, LEUB, leucine biosynthesis; HET: 2PE; 1.83A {Thermus thermophilus} PDB: 2y40_A 2y41_A* 2y42_A* 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1g2u_A 1gc9_A 1osj_A 1ipd_A 1gc8_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Length = 359 Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics PSI, protein structure initiative, joint center for structu genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Length = 366 Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Length = 363 Back     alignment and structure
>3vmk_A 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase; HET: IPM; 1.48A {Shewanella benthica} PDB: 3vmj_A* 3vl2_A* 3vkz_A* 3vl4_A* 3vl6_A* 3vl7_A* 3vl3_A* Length = 375 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, deca 100.0
3flk_A364 Tartrate dehydrogenase/decarboxylase; cytoplasm, l 100.0
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, l 100.0
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycl 100.0
3ty4_A366 Probable homoisocitrate dehydrogenase; B-hydroxyac 100.0
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycl 100.0
3udu_A361 3-isopropylmalate dehydrogenase; structural genomi 100.0
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogen 100.0
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structura 100.0
3vmk_A375 3-isopropylmalate dehydrogenase; oxidoreductase, d 100.0
2y3z_A359 3-isopropylmalate dehydrogenase; oxidoreductase, L 100.0
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxid 100.0
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPP 100.0
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate 100.0
3u1h_A390 3-isopropylmalate dehydrogenase; oxidored; 2.80A { 100.0
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarbo 100.0
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, 100.0
3dms_A427 Isocitrate dehydrogenase [NADP]; struc genomics, s 100.0
1tyo_A435 Isocitrate dehydrogenase; enzyme-ethenonadp comple 100.0
3r8w_A405 3-isopropylmalate dehydrogenase 2, chloroplastic; 100.0
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh 100.0
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2 100.0
2uxq_A402 Isocitrate dehydrogenase native; psychrophilic, co 100.0
1lwd_A413 Isocitrate dehydrogenase; tricarboxylic acid cycle 100.0
2qfy_A427 Isocitrate dehydrogenase [NADP]; rossmann fold, ox 100.0
3us8_A427 Isocitrate dehydrogenase [NADP]; PSI-biology, stru 100.0
1zor_A399 Isocitrate dehydrogenase; wild type enzyme, CIS-pr 100.0
4aoy_A402 Isocitrate dehydrogenase [NADP]; oxidoreductase, t 100.0
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 82.76
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosyn; 1.85A {Thermus thermophilus} PDB: 3asj_A* 3ah3_A Back     alignment and structure
Probab=100.00  E-value=4.4e-50  Score=354.03  Aligned_cols=137  Identities=28%  Similarity=0.360  Sum_probs=132.0

Q ss_pred             eeecceecccceeeeEEeeecccccHHHHHHHHHHHhCCCCcEEEEeCCCccccccHHHHHHHHHHHhhCCCeEEEEEEE
Q psy3672           3 LYLLDRLRQLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMIT   82 (178)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~t~~~~eRiar~AFe~A~~~~rk~Vt~vhKaNvlk~tdglf~~i~~eva~eYpdv~~~~~~v   82 (178)
                      +|++.+.+..+++.+++++|++++|||+|+||++|++|+||+||+|||+||||.|||+|+++|+|++++||+|+++++++
T Consensus       123 ~Y~g~~~~~~~~a~~~~~~T~~~~eRiar~AF~~A~~r~rkkvt~v~KaNvlk~t~glf~~~~~eva~eyp~I~~~~~~v  202 (333)
T 1x0l_A          123 LYVEQERRYLDVAIADAVISKKASERIGRAALRIAEGRPRKTLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIV  202 (333)
T ss_dssp             TCCCCEEEETTEEEEEEEEEHHHHHHHHHHHHHHHHTSTTCEEEEEECTTTCTTHHHHHHHHHHHHHTTCTTSEEEEEEH
T ss_pred             eeccccccCCCeEEEEEEecHHHHHHHHHHHHHHHHhcCCCeEEEEecCccchhhhHHHHHHHHHHHHHCCCceEEEEEH
Confidence            68988765568999999999999999999999999999889999999999999999999999999999999999999999


Q ss_pred             eeeeccccccceeEEEeecccccHHHHHHhhCCCCCcEEEeeCCCcccccccccccccccccccCccccccCCCCceecC
Q psy3672          83 GFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRTGSCQQS  162 (178)
Q Consensus        83 ~~~~~~~~~~~~i~~~~~~i~~Da~~~~LV~~P~~fDViv~~Nl~GDILSDlaA~l~GglGl~psa~~~~ig~~~~~fep  162 (178)
                                            |+|+||||++|++||||||+|||||||||++|+++||+||+||+|   +|+.+++|||
T Consensus       203 ----------------------D~~~m~lv~~P~~FDVivt~NlfGDIlSD~aa~l~GslGl~psan---ig~~~a~fEp  257 (333)
T 1x0l_A          203 ----------------------DNCAMQLVMRPERFDVIVTTNLLGDILSDLAAGLVGGLGLAPSGN---IGDTTAVFEP  257 (333)
T ss_dssp             ----------------------HHHHHHHHHCGGGCSEEEECHHHHHHHHHHHHHHTTCSTTCEEEE---ECSSCEEEEE
T ss_pred             ----------------------HHHHHHHhhCcccceEEEEcCccchhHhHHHHhhcCCcccceeeE---ECCCceEEeC
Confidence                                  999999999999999999999999999999999999999999999   7888999999


Q ss_pred             cc
Q psy3672         163 CD  164 (178)
Q Consensus       163 ~~  164 (178)
                      +|
T Consensus       258 ~H  259 (333)
T 1x0l_A          258 VH  259 (333)
T ss_dssp             SS
T ss_pred             CC
Confidence            98
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Back     alignment and structure
>1w0d_A 3-isopropylmalate dehydrogenase; oxidoreductase, leucine biosynthesis, NAD, ST genomics, PSI, protein structure initiative; 1.65A {Mycobacterium tuberculosis} SCOP: c.77.1.1 PDB: 2g4o_A Back     alignment and structure
>3blx_A Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_A 3blv_A* Back     alignment and structure
>3ty4_A Probable homoisocitrate dehydrogenase; B-hydroxyacid oxidative decarboxylase, amino-acid biosynthes lysine biosynthesis; 1.55A {Schizosaccharomyces pombe} SCOP: c.77.1.0 PDB: 3ty3_A Back     alignment and structure
>3blx_B Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_B* 3blv_B Back     alignment and structure
>3udu_A 3-isopropylmalate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.85A {Campylobacter jejuni} SCOP: c.77.1.1 PDB: 3udo_A Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics PSI, protein structure initiative, joint center for structu genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Back     alignment and structure
>3vmk_A 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase; HET: IPM; 1.48A {Shewanella benthica} PDB: 3vml_A* 3vmj_A* 3vl2_A* 3vkz_A* 3vl4_A* 3vl6_A* 3vl7_A* 3vl3_A* Back     alignment and structure
>2y3z_A 3-isopropylmalate dehydrogenase; oxidoreductase, LEUB, leucine biosynthesis; HET: 2PE; 1.83A {Thermus thermophilus} PDB: 2y40_A 2y41_A* 2y42_A* 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1g2u_A 1gc9_A 1osj_A 1ipd_A 1gc8_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Acidithiobacillus ferrooxidans} SCOP: c.77.1.1 Back     alignment and structure
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus} Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Back     alignment and structure
>3u1h_A 3-isopropylmalate dehydrogenase; oxidored; 2.80A {Bacillus SP} PDB: 2ayq_A 1v53_A 1v5b_A Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; struc genomics, seattle structural genomics center for infectious ssgcid, glyoxylate bypass, manganese; 1.65A {Burkholderia pseudomallei} SCOP: c.77.1.1 PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 3lcb_C* 4aj3_A* 4aja_A* 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A ... Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Back     alignment and structure
>3r8w_A 3-isopropylmalate dehydrogenase 2, chloroplastic; dimer, isocitrate and isopropylmalate dehydrogenases family, biosynthesis; 2.25A {Arabidopsis thaliana} Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Back     alignment and structure
>2uxq_A Isocitrate dehydrogenase native; psychrophilic, cold adaptation, thermal stability, oxidoreductase; HET: SO4 PEG; 1.75A {Desulfotalea psychrophila} PDB: 2uxr_A* Back     alignment and structure
>1lwd_A Isocitrate dehydrogenase; tricarboxylic acid cycle, oxidoreductase, NADP; HET: ICT; 1.85A {Sus scrofa} SCOP: c.77.1.1 PDB: 1t0l_A* 1t09_A* 3mas_B* 3map_A* 3mar_A* 3mas_A* 3inm_A* 2cmj_A* 2cmv_A* Back     alignment and structure
>2qfy_A Isocitrate dehydrogenase [NADP]; rossmann fold, oxidoreductase; HET: AKG; 2.10A {Saccharomyces cerevisiae} PDB: 2qfw_A* 2qfx_A* 2qfv_A* Back     alignment and structure
>3us8_A Isocitrate dehydrogenase [NADP]; PSI-biology, structural genomics; 2.25A {Sinorhizobium meliloti} Back     alignment and structure
>1zor_A Isocitrate dehydrogenase; wild type enzyme, CIS-proline, thermostable, oxidoreductase; 2.24A {Thermotoga maritima} Back     alignment and structure
>4aoy_A Isocitrate dehydrogenase [NADP]; oxidoreductase, temperature adaptation, thermophilic, psychr NADP+ selectivity, domain movements; 2.35A {Clostridium thermocellum} PDB: 4aou_A Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1pb1a_416 c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Esch 3e-11
d1lwda_ 413 c.77.1.1 (A:) NADP-dependent isocitrate dehydrogen 6e-08
d1hqsa_423 c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Baci 6e-07
d1vlca_362 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 1e-06
d1t0la_ 414 c.77.1.1 (A:) NADP-dependent isocitrate dehydrogen 3e-06
d1cnza_363 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 6e-06
d1v53a1356 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase 6e-05
d1a05a_357 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 4e-04
d1g2ua_345 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 0.001
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Length = 416 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: Dimeric isocitrate & isopropylmalate dehydrogenases
domain: Isocitrate dehydrogenase, ICDH
species: Escherichia coli [TaxId: 562]

 Score = 58.6 bits (141), Expect = 3e-11
 Identities = 24/95 (25%), Positives = 37/95 (38%), Gaps = 2/95 (2%)

Query: 41  NRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTNRKMITGFIWTTRDINVFIWTIRR 100
           +R  VT VHK NIMK  +G F +   ++A+                   +    I     
Sbjct: 221 DRDSVTLVHKGNIMKFTEGAFKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDV 280

Query: 101 IITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMV 135
           I   F    QI+  P ++DV+   NL G+     +
Sbjct: 281 IADAFLQ--QILLRPAEYDVIACMNLNGDYISDAL 313
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 413 Back     information, alignment and structure
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} Length = 423 Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Length = 362 Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 414 Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Length = 363 Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Length = 356 Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Length = 357 Back     information, alignment and structure
>d1g2ua_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} Length = 345 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1w0da_337 3-isopropylmalate dehydrogenase, IPMDH {Mycobacter 100.0
d1vlca_362 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga 100.0
d1g2ua_345 3-isopropylmalate dehydrogenase, IPMDH {Thermus th 100.0
d1cnza_363 3-isopropylmalate dehydrogenase, IPMDH {Salmonella 100.0
d1hqsa_423 Isocitrate dehydrogenase, ICDH {Bacillus subtilis 100.0
d1a05a_357 3-isopropylmalate dehydrogenase, IPMDH {Thiobacill 100.0
d1pb1a_416 Isocitrate dehydrogenase, ICDH {Escherichia coli [ 100.0
d1wpwa_336 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus 100.0
d1v53a1356 3-isopropylmalate dehydrogenase, IPMDH {Bacillus c 100.0
d1lwda_413 NADP-dependent isocitrate dehydrogenase {Pig (Sus 100.0
d1t0la_414 NADP-dependent isocitrate dehydrogenase {Human (Ho 100.0
>d1w0da_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: Dimeric isocitrate & isopropylmalate dehydrogenases
domain: 3-isopropylmalate dehydrogenase, IPMDH
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=1.9e-44  Score=315.03  Aligned_cols=136  Identities=23%  Similarity=0.280  Sum_probs=127.0

Q ss_pred             eeecceec-----ccceeeeEEeeecccccHHHHHHHHHHHhCCCCcEEEEeCCCccccccHHHHHHHHHHHhhCCCeEE
Q psy3672           3 LYLLDRLR-----QLSVCDKVSLRYEETIDPCPRFSYVQDLLSNRKKVTAVHKANIMKLGDGLFLNSCKEMAKLYPVWTN   77 (178)
Q Consensus         3 ~~~~~~~~-----~~~~~~~~~~~t~~~~eRiar~AFe~A~~~~rk~Vt~vhKaNvlk~tdglf~~i~~eva~eYpdv~~   77 (178)
                      +|++.+.+     ..+++.+++++|+.+++||+|+||++|+++ |++||++||+||||.|||+|+++++|++++||++++
T Consensus       128 ~Y~g~~~~~~~~~~~~~a~~~~~~t~~~~~Ri~~~Af~~A~~~-r~~Vt~v~KaNv~~~t~g~f~~~~~~va~~yp~i~~  206 (337)
T d1w0da_         128 PYTGNGGAIRVGTPNEVATEVSVNTAFGVRRVVADAFERARRR-RKHLTLVHKTNVLTFAGGLWLRTVDEVGECYPDVEV  206 (337)
T ss_dssp             GGGCCEEEESTTSTTCEEEEEEEEEHHHHHHHHHHHHHHHHHT-TSEEEEEECTTTSHHHHHHHHHHHHHHHTTCTTSEE
T ss_pred             ccccCCCeeecCCCceEEEEEEeecchheeehhhhhhhHhhcc-CceEEEEECcchhhhhHHHHHHHHHHHhhcCCcchh
Confidence            47776643     346999999999999999999999999987 799999999999999999999999999999999999


Q ss_pred             EEEEEeeeeccccccceeEEEeecccccHHHHHHhhCCCCCcEEEeeCCCcccccccccccccccccccCccccccCCC-
Q psy3672          78 RKMITGFIWTTRDINVFIWTIRRIITVFNWTRQIVSNPHQFDVMVMPNLYGNIFDVMVMPNLYGNIVDNLASDSVISRT-  156 (178)
Q Consensus        78 ~~~~v~~~~~~~~~~~~i~~~~~~i~~Da~~~~LV~~P~~fDViv~~Nl~GDILSDlaA~l~GglGl~psa~~~~ig~~-  156 (178)
                      +++++                      |++++|||++|++||||||+|||||||||++|+++||+|++||+|   +|+. 
T Consensus       207 ~~~~v----------------------D~~~~~lv~~P~~fdViv~~Nl~GDIlSDlaa~l~GglGl~psan---ig~~~  261 (337)
T d1w0da_         207 AYQHV----------------------DAATIHMITDPGRFDVIVTDNLFGDIITDLAAAVCGGIGLAASGN---IDATR  261 (337)
T ss_dssp             EEEEH----------------------HHHHHHHHHCGGGCSEEEECHHHHHHHHHHHHHHTTCGGGCEEEE---ECTTC
T ss_pred             hhhhH----------------------HHHHHHHHhcccccceeeccHHHHHHHHHHHHHhcCCcccCCccc---ccccc
Confidence            99999                      999999999999999999999999999999999999999999999   5555 


Q ss_pred             --CceecCcc
Q psy3672         157 --GSCQQSCD  164 (178)
Q Consensus       157 --~~~fep~~  164 (178)
                        .++|||+|
T Consensus       262 ~~~a~fEp~H  271 (337)
T d1w0da_         262 ANPSMFEPVH  271 (337)
T ss_dssp             SSCEEEEESS
T ss_pred             ccceeccccc
Confidence              48999998
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g2ua_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wpwa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure