Diaphorina citri psyllid: psy3682

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MSVEYCYQRNWHKQAVTSVILGLFKHIKKAQRRTRQASTAANSVRTEQKASKVLGLVFFTFVLCWAPFFLLQILQAICPTGYCTIPEDLGIVCLWLGYFSSILNPIIYTIFNRTFRAAFIRLLKCKCGQVTKPIRYRSVNDRATASSGPATVPLTLPPTPGRTLSVSMQDVSHTYPTNTKKQEAGGKGRYKKEVKKRERGELEAVFMNRAEMSSDDVR
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccc
**************************************************SKVLGLVFFTFVLCWAPFFLLQILQAICPTGYCTIPEDLGIVCLWLGYFSSILNPIIYTIFNRTFRAAFIRLLKCKCGQVTKPIRYRS********************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVEYCYQRNWHKQAVTSVILGLFKHIKKAQRRTRQASTAANSVRTEQKASKVLGLVFFTFVLCWAPFFLLQILQAICPTGYCTIPEDLGIVCLWLGYFSSILNPIIYTIFNRTFRAAFIRLLKCKCGQVTKPIRYRSVNDRATASSGPATVPLTLPPTPGRTLSVSMQDVSHTYPTNTKKQEAGGKGRYKKEVKKRERGELEAVFMNRAEMSSDDVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004993 [MF]serotonin receptor activityprobableGO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0008227
GO:2000021 [BP]regulation of ion homeostasisprobableGO:0008150, GO:0065007, GO:0050789, GO:0032844
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0007210 [BP]serotonin receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0007191 [BP]adenylate cyclase-activating dopamine receptor signaling pathwayprobableGO:0065007, GO:0044700, GO:0051716, GO:0008150, GO:0007212, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0007188, GO:0007189, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0007200 [BP]phospholipase C-activating G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0007204 [BP]elevation of cytosolic calcium ion concentrationprobableGO:0019725, GO:0072507, GO:0072503, GO:0051480, GO:0006874, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0006875, GO:0065007, GO:0044763, GO:0055074, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0045937 [BP]positive regulation of phosphate metabolic processprobableGO:0019220, GO:0009893, GO:0019222, GO:0010562, GO:0031323, GO:0050794, GO:0051174, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0031325, GO:0048522
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0030594 [MF]neurotransmitter receptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0051378 [MF]serotonin bindingprobableGO:0043169, GO:0097159, GO:0043167, GO:0003674, GO:0005488, GO:0043176, GO:1901363
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KS9, chain A
Confidence level:very confident
Coverage over the Query: 15-126
View the alignment between query and template
View the model in PyMOL