Diaphorina citri psyllid: psy3691


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
LSDKSGIIIDGPGNYSIDVKCSWLIDASDTPNATIRLHFNSFATECGWDHLYIFDGDSVHAPLLGVFSGLMYEGDYSIHRVPDVKCFTITNELGNTGIQIVLGNDFVQLWEVGNVYLTHKNELYETSKDLISPKILK
cccccCEEEccccccccccccEEEEEEccccccEEEEEEcEEEccccccEEEEEccccccccEEEEEEcccccccCEECcccEEEEEEEccccccccEEEEEcccEEEEEEcccccccccccccccccccccccccc
LSDKSGIIIDGPGNYSIDVKCSWLIDASDTPNATIRLHFNSFATECGWDHLYIFDGDSVHAPLLGVFSGLMYEGDYSIHRVPDVKCFTITNELGNTGIQIVLGNDFVQLWEVGNVYLTHKNELYETSKDLISPKI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LSDKSGIIIDGPGNYSIDVKCSWLIDASDTPNATIRLHFNSFATECGWDHLYIFDGDSVHAPLLGVFSGLMYEGDYSIHRVPDVKCFTITNELGNTGIQIVLGNDFVQLWEVGNVYLTHKNELYETSKDLISPKILK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Attractin Involved in the initial immune cell clustering during inflammatory response and may regulate chemotactic activity of chemokines (By similarity). May play a role in melanocortin signaling pathways that regulate energy homeostasis and hair color. Low-affinity receptor for agouti. Has a critical role in normal myelination in the central nervous system.confidentQ9WU60
Attractin Involved in the initial immune cell clustering during inflammatory response and may regulate chemotactic activity of chemokines. May play a role in melanocortin signaling pathways that regulate energy homeostasis and hair color. Low-affinity receptor for agouti (By similarity). Has a critical role in normal myelination in the central nervous system.confidentO75882
Attractin Involved in the initial immune cell clustering during inflammatory response and may regulate chemotactic activity of chemokines (By similarity). May play a role in melanocortin signaling pathways that regulate energy homeostasis and hair color. Low-affinity receptor for agouti (By similarity). Has a critical role in normal myelination in the central nervous system.confidentQ99J86

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KQ4, chain B
Confidence level:very confident
Coverage over the Query: 1-104
View the alignment between query and template
View the model in PyMOL