Diaphorina citri psyllid: psy3697


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MYTGEACDVPICPNNCSYSSVNSCPSSKSDKPCSGQGVCIEGVCTCDAMYTGEACDVPICPNNCSYSNGVCKHEFHRCECMDKYKEMKQLFDACDVSKNAHSVACPSFDELENPIMS
cccccccccccccccccccccccccccccccccccccEECccEEEEcccccccccccccccccccccccEEEcccccEEEccccccccccccccccccccccccccccccccccccc
MYTGEACDVPICPNNCSYSSVNSCPSSKSDKPCSGQGVCIEGVCTCDAMYTGEACDVPICPNNCSYSNGVCKHEFHRCECMDKYKEMKQLFDACDVSKNAHSVACPSFDELENPIM*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYTGEACDVPICPNNCSYSSVNSCPSSKSDKPCSGQGVCIEGVCTCDAMYTGEACDVPICPNNCSYSNGVCKHEFHRCECMDKYKEMKQLFDACDVSKNAHSVACPSFDELENPIMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processprobable
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0044420 [CC]extracellular matrix partprobableGO:0005575, GO:0031012
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0005578 [CC]proteinaceous extracellular matrixprobableGO:0005575, GO:0005576, GO:0044421, GO:0031012
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YGQ, chain A
Confidence level:very confident
Coverage over the Query: 1-56
View the alignment between query and template
View the model in PyMOL