Diaphorina citri psyllid: psy3706

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---

MFLRIFLSYLVVTCAQSKNNNRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELDKAKKLSEVKLPGFNIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGSRQFPCITGLLSFMKQGPGVSVSCELSVSSFFSAVARMFLRIFLSYLVVTCAQSKNNNNKHNKSGF

cHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHccccHHHHHcccccccccccccccccEEEccccccccccccEEEEEECcccccccccEEEEEcccccHHHHHHHHHHcccEEEcccccccccccccccccccccccEEEEECccccccEEccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHccccccccccEEEEEEcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHccccccccccccHHHHHcccccccccHHHHHHHHHHHcccccCEECccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable serine carboxypeptidase CPVL	May be involved in the digestion of phagocytosed particles in the lysosome, participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation.	confident	Q4QR71
Probable serine carboxypeptidase CPVL	May be involved in the digestion of phagocytosed particles in the lysosome, participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation.	confident	Q9D3S9
Venom serine carboxypeptidase		confident	C9WMM5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009505 [CC]	plant-type cell wall	probable	GO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IVY, chain A
Confidence level:very confident
Coverage over the Query: 62-417
View the alignment between query and template
View the model in PyMOL