Psyllid ID: psy3706

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MFLRIFLSYLVVTCAQSKNNNRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELDKAKKLSEVKLPGFNIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGSRQFPCITGLLSFMKQGPGVSVSCELSVSSFFSAVARMFLRIFLSYLVVTCAQSKNNNNKHNKSGF
cHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHccccHHHHHHccccccccccccccccEEEccccccccccccEEEEEEEcccccccccEEEEEcccccHHHHHHHHHHHccEEEcccccccccccccccccccccccEEEEEEccccccEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHcccccccccccHHHHHHHccccccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccc
cHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccEEcccccccccHHHHccccccccccccEcEEEEEEEEcccccHHccEEEEEEEEcccccHHHccEEEEEcccccEccHHHHHcccccEEEccccccccccEEEcccccHHHcEEEEEEcccccccEEEcccccccccccHHHHHHHHHHHHHHHHHccHHccccEEEEEccccccHHHHHHHHHHHHccccccEEEEEEEEEcccccccHHHccHHHHHHHHHHccHHHHHHHHHHHccccHcccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccHHHHcccccccccHHHHHHHHHHcccEEEEcccccEEccHHHHHHHHHccccEEEEEEEEEEEEEcccccccccccc
MFLRIFLSYLVVTCAqsknnnryptlpeftdvfqnqpfasadvgspliltDYIERGeldkakklsevklpgfniesysgffrvnstedkkyssalffwffpaeeypsnapVLLWLNAglgsssmtglfqengplqlnknkkrqplpyvekrktywsknhnviyidnpvgrgfsfaedydlysrnktQVGLNLYIALVQFFKVFNeyqrndffitgetyigqfgtslgfniyqnnpvtdikINLKgfalgndltdplYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFtnlynyqvpiadntpntLMVELFNTTTFRKAVHvgnttydtsvtedvflkndimgsrqfpcITGLLsfmkqgpgvsvsceLSVSSFFSAVARMFLRIFLSYLVVTCAqsknnnnkhnksgf
MFLRIFLSYLVVTCAQSKNNNRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELDkakklsevklpgfniesysgfFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMTGLFQEngplqlnknkkrqplpyvekrktywsknhnviyidnpvgRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGSRQFPCITGLLSFMKQGPGVSVSCELSVSSFFSAVARMFLRIFLSYLVVTCaqsknnnnkhnksgf
MFLRIFLSYLVVTCAQSKNNNRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELDKAKKLSEVKLPGFNIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKtiyntltnftnlynyQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGSRQFPCITGLLSFMKQGPGVSVSCELSVSSFFSAVARMFLRIFLSYLVVTCAQSknnnnkhnkSGF
*FLRIFLSYLVVTCAQSKNNNRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELDKAKKLSEVKLPGFNIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSS***GL******************PYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGSRQFPCITGLLSFMKQGPGVSVSCELSVSSFFSAVARMFLRIFLSYLVVTCA**************
MFLRIFLSYLVVTCAQ******************************LILTDYI***************LPGFNIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGSRQFPCITGLLSFMKQGPGVSVSCELSVSSFFSAVARMFLRIFLSYLVVTCA**************
MFLRIFLSYLVVTCAQSKNNNRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELDKAKKLSEVKLPGFNIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGSRQFPCITGLLSFMKQGPGVSVSCELSVSSFFSAVARMFLRIFLSYLVVTCAQSKNNNNKHNKSGF
MFLRIFLSYLVVTCAQSKNNNRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELDKAKKLSEVKLPGFNIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGSRQFPCITGLLSFMKQGPGVSVSCELSVSSFFSAVARMFLRIFLSYLVVTCAQSKN**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLRIFLSYLVVTCAQSKNNNRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELDKAKKLSEVKLPGFNIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGSRQFPCITGLLSFMKQGPGVSVSCELSVSSFFSAVARMFLRIFLSYLVVTCAQSKNNNNKHNKSGF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query443 2.2.26 [Sep-21-2011]
C9WMM5467 Venom serine carboxypepti yes N/A 0.808 0.766 0.427 2e-74
Q9H3G5476 Probable serine carboxype yes N/A 0.760 0.707 0.386 1e-65
Q5RFE4476 Probable serine carboxype yes N/A 0.758 0.705 0.381 2e-63
Q4QR71478 Probable serine carboxype yes N/A 0.792 0.734 0.362 2e-60
Q9D3S9478 Probable serine carboxype yes N/A 0.792 0.734 0.354 2e-59
P42660471 Vitellogenic carboxypepti N/A N/A 0.781 0.734 0.347 2e-58
Q869Q8500 Probable serine carboxype yes N/A 0.781 0.692 0.289 1e-33
Q9M9Q6444 Serine carboxypeptidase-l yes N/A 0.659 0.657 0.289 8e-31
Q8L7B2497 Serine carboxypeptidase-l no N/A 0.566 0.505 0.32 5e-30
Q9LSV8494 Serine carboxypeptidase-l no N/A 0.697 0.625 0.315 2e-29
>sp|C9WMM5|VCP_APIME Venom serine carboxypeptidase OS=Apis mellifera PE=2 SV=1 Back     alignment and function desciption
 Score =  280 bits (715), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 224/377 (59%), Gaps = 19/377 (5%)

Query: 5   IFLSYLVVTCAQSKNNNRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELDKAKKL 64
           + L +L          N YP  P++  +   +     D G PL LT  IE G++D+A+  
Sbjct: 5   VLLQFLFFISFARGFTNVYPK-PKYCPLLHEE-----DAGIPLFLTPLIENGKIDEARNK 58

Query: 65  SEVKLPGFN-IESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSS 123
           + ++      I SY+GF  VN    KKY+S +FFWFFPA   P  APV+LWL  G G++S
Sbjct: 59  AVIQHKEVEAISSYAGFLTVN----KKYNSNMFFWFFPALHDPKTAPVVLWLQGGPGATS 114

Query: 124 MTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSR 183
           M GLF ENGP  + KNK       ++ R+  W+K HN++YIDNPVG GFSF ED   Y+ 
Sbjct: 115 MYGLFLENGPFIVTKNKT------LKMREYSWNKCHNLLYIDNPVGTGFSFTEDERGYAT 168

Query: 184 NKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINL 243
           N+T VG +++ ALVQFF++F E Q NDF++TGE+Y G++  ++   I   N    IKINL
Sbjct: 169 NETHVGRDVHTALVQFFELFPELQTNDFYVTGESYGGKYVPAVSHAIKDYNIKAKIKINL 228

Query: 244 KGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEAFDVYD 303
           KG A+GN LTDP+  + Y  YLYQ+GL+D NGR LF+  E+Q  +LI Q+K  EAFD++D
Sbjct: 229 KGLAIGNGLTDPVNQLDYGDYLYQLGLLDANGRNLFQKYEEQGKNLIKQEKWLEAFDLFD 288

Query: 304 ELIVGTF-HDKTIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVGNTTY- 361
           EL+ G      ++Y  LT F   +NY      +  +  MVE       RKA+HVGN T+ 
Sbjct: 289 ELLDGDITQQPSLYKNLTGFDYYFNYLHEKDPSNDSDYMVEWLQRADVRKAIHVGNRTFI 348

Query: 362 DTSVTEDVFLKNDIMGS 378
             S   + ++K D+M S
Sbjct: 349 PESKKVEKYMKADVMQS 365

Apis mellifera (taxid: 7460)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q9H3G5|CPVL_HUMAN Probable serine carboxypeptidase CPVL OS=Homo sapiens GN=CPVL PE=1 SV=2 Back     alignment and function description
>sp|Q5RFE4|CPVL_PONAB Probable serine carboxypeptidase CPVL OS=Pongo abelii GN=CPVL PE=2 SV=1 Back     alignment and function description
>sp|Q4QR71|CPVL_RAT Probable serine carboxypeptidase CPVL OS=Rattus norvegicus GN=CPVL PE=2 SV=1 Back     alignment and function description
>sp|Q9D3S9|CPVL_MOUSE Probable serine carboxypeptidase CPVL OS=Mus musculus GN=Cpvl PE=2 SV=2 Back     alignment and function description
>sp|P42660|VCP_AEDAE Vitellogenic carboxypeptidase OS=Aedes aegypti GN=VCP PE=1 SV=3 Back     alignment and function description
>sp|Q869Q8|CPVL_DICDI Probable serine carboxypeptidase CPVL OS=Dictyostelium discoideum GN=cpvl PE=3 SV=1 Back     alignment and function description
>sp|Q9M9Q6|SCP50_ARATH Serine carboxypeptidase-like 50 OS=Arabidopsis thaliana GN=SCPL50 PE=2 SV=1 Back     alignment and function description
>sp|Q8L7B2|SCP20_ARATH Serine carboxypeptidase-like 20 OS=Arabidopsis thaliana GN=SCPL20 PE=2 SV=2 Back     alignment and function description
>sp|Q9LSV8|SCP21_ARATH Serine carboxypeptidase-like 21 OS=Arabidopsis thaliana GN=SCPL21 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query443
322796735468 hypothetical protein SINV_11635 [Solenop 0.812 0.769 0.431 2e-73
157113685484 retinoid-inducible serine carboxypeptida 0.778 0.712 0.417 1e-72
380017504467 PREDICTED: venom serine carboxypeptidase 0.808 0.766 0.421 1e-72
226533687467 venom serine carboxypeptidase precursor 0.808 0.766 0.427 1e-72
345483324467 PREDICTED: venom serine carboxypeptidase 0.762 0.723 0.445 9e-72
340723441468 PREDICTED: venom serine carboxypeptidase 0.767 0.726 0.434 1e-70
350427119468 PREDICTED: venom serine carboxypeptidase 0.738 0.698 0.444 1e-70
332019529471 Putative serine carboxypeptidase CPVL [A 0.796 0.749 0.433 2e-70
357631511487 vitellogenic carboxypeptidase [Danaus pl 0.769 0.700 0.420 5e-69
156546630466 PREDICTED: venom serine carboxypeptidase 0.742 0.706 0.432 9e-69
>gi|322796735|gb|EFZ19168.1| hypothetical protein SINV_11635 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  282 bits (722), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 166/385 (43%), Positives = 225/385 (58%), Gaps = 25/385 (6%)

Query: 3   LRIFLSYLVVTCAQSKNN---NRYPTLPEFTDVFQNQPFASADVGSPLILTDYIERGELD 59
           + I LS L +       +   N YP L +F          + D G+PL LT  IE G++D
Sbjct: 4   IAIILSALFLVLPHESTSGFLNVYPQLKQFK--------LTEDAGTPLFLTPLIENGKID 55

Query: 60  KAKKLSEVKLPGF-NIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAG 118
           +A+  S V+     +I SYSG+F VN    K+Y+S LFFWFFPA   P  APV+LWL  G
Sbjct: 56  EARTKSVVQHKEMGDISSYSGYFTVN----KEYNSNLFFWFFPAMHNPKTAPVVLWLQGG 111

Query: 119 LGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDY 178
            G++SM GLF ENGP  +  NK       +  RK  W+  HNVIYIDNPVG G+SF E+ 
Sbjct: 112 PGATSMFGLFMENGPFIITANKT------LTMRKYSWNIAHNVIYIDNPVGTGYSFTENE 165

Query: 179 DLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTD 238
             Y+ N+TQVG  ++ ALVQFF +F E Q NDFF+TGE+Y G++  ++   I   N    
Sbjct: 166 KGYATNETQVGREIHTALVQFFLLFPELQNNDFFVTGESYAGKYVPAVSHAIKDYNIKAK 225

Query: 239 IKINLKGFALGNDLTDPLYMMLYSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQKKLGEA 298
            KINLKG A+GN L DP   +LYS YLYQ+GLID+NG+  F+  EK+  + I QK   EA
Sbjct: 226 TKINLKGLAIGNGLCDPENQLLYSDYLYQLGLIDENGKTQFQVYEKKGREFIKQKNYLEA 285

Query: 299 FDVYDELIVGTFHDK-TIYNTLTNFTNLYNYQVPIADNTPNTLMVELFNTTTFRKAVHVG 357
           F ++D L+ G  +   ++++ LT F N YNY + + D   +  M EL      R+A+HVG
Sbjct: 286 FKIFDTLLNGDLNRTPSLFHNLTGFDNYYNY-LFVKDGNDSDWMSELIQRADVRRAIHVG 344

Query: 358 NTTYDTSVTE-DVFLKNDIMGSRQF 381
           N ++    T  +  LK D+M S  F
Sbjct: 345 NNSFHVETTTVEEHLKEDVMQSVVF 369

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157113685|ref|XP_001652055.1| retinoid-inducible serine carboxypeptidase (serine carboxypeptidase [Aedes aegypti] gi|108877637|gb|EAT41862.1| AAEL006542-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|380017504|ref|XP_003692695.1| PREDICTED: venom serine carboxypeptidase-like [Apis florea] Back     alignment and taxonomy information
>gi|226533687|ref|NP_001152775.1| venom serine carboxypeptidase precursor [Apis mellifera] gi|313471717|sp|C9WMM5.1|VCP_APIME RecName: Full=Venom serine carboxypeptidase; AltName: Allergen=Api m 9; Flags: Precursor gi|224959857|gb|ACN71203.1| venom serine carboxypeptidase precursor [Apis mellifera] Back     alignment and taxonomy information
>gi|345483324|ref|XP_003424792.1| PREDICTED: venom serine carboxypeptidase-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340723441|ref|XP_003400098.1| PREDICTED: venom serine carboxypeptidase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350427119|ref|XP_003494658.1| PREDICTED: venom serine carboxypeptidase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332019529|gb|EGI60008.1| Putative serine carboxypeptidase CPVL [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357631511|gb|EHJ78981.1| vitellogenic carboxypeptidase [Danaus plexippus] Back     alignment and taxonomy information
>gi|156546630|ref|XP_001602950.1| PREDICTED: venom serine carboxypeptidase-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query443
ZFIN|ZDB-GENE-031219-2478 cpvl "carboxypeptidase, vitell 0.740 0.686 0.405 1.1e-62
UNIPROTKB|Q9H3G5476 CPVL "Probable serine carboxyp 0.767 0.714 0.373 7.1e-61
UNIPROTKB|F1MX68478 CPVL "Uncharacterized protein" 0.580 0.537 0.437 8.8e-59
FB|FBgn0038738482 CG4572 [Drosophila melanogaste 0.841 0.773 0.374 8.4e-58
MGI|MGI:1918537478 Cpvl "carboxypeptidase, vitell 0.794 0.736 0.341 4.2e-56
RGD|1563609478 Cpvl "carboxypeptidase, vitell 0.794 0.736 0.349 4.2e-56
UNIPROTKB|F6XKB3479 CPVL "Uncharacterized protein" 0.729 0.674 0.385 5.3e-56
UNIPROTKB|E2QZ23446 CPVL "Uncharacterized protein" 0.729 0.724 0.367 1.7e-52
UNIPROTKB|F6XKA5446 CPVL "Uncharacterized protein" 0.722 0.717 0.367 1.3e-50
UNIPROTKB|F1SIG3446 CPVL "Uncharacterized protein" 0.765 0.760 0.342 3.2e-49
ZFIN|ZDB-GENE-031219-2 cpvl "carboxypeptidase, vitellogenic-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 640 (230.4 bits), Expect = 1.1e-62, P = 1.1e-62
 Identities = 138/340 (40%), Positives = 200/340 (58%)

Query:    41 ADVGSPLILTDYIERGELDKAKKLSEV-KLPGFNIESYSGFFRVNSTEDKKYSSALFFWF 99
             AD G PL+LT Y+E+G++++AKKLS V  LPG N++SYSG+  VN T    Y+S LFFWF
Sbjct:    41 ADPGKPLMLTPYLEQGKIEEAKKLSLVGPLPGANVKSYSGYLTVNKT----YNSNLFFWF 96

Query:   100 FPAEEYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNH 159
             FPA+E P  APVLLWL  G G +SM GLF E+GP  + KN     L Y   R   W+  +
Sbjct:    97 FPAQERPETAPVLLWLQGGPGGTSMFGLFVEHGPYFVYKNLT---LGY---RHFPWTSRY 150

Query:   160 NVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYI 219
             +V+YIDNPVG G+SF ED   +++N+  VG +LY AL QFF++F E+Q N F+ TGE+Y 
Sbjct:   151 SVLYIDNPVGTGWSFTEDDRGFAQNQDDVGRDLYSALTQFFQIFREFQSNPFYATGESYA 210

Query:   220 GQFGTSLGFNIYQNNPVTDIKINLKGFALGNDLTDPLYMML-YSKYLYQIGLIDDNGRKL 278
             G++  ++G+ I++NNP   +KIN KG A+G+ L DP  M+  Y+ +LYQ GL+D+  R+ 
Sbjct:   211 GKYVPAIGYYIHRNNPSAKVKINFKGVAIGDGLCDPELMLGGYADFLYQTGLVDELQRQH 270

Query:   279 FEYKEKQITDLIFQKKLGEAFDVYDELIVGTFHDKXXXXXXXXXXXXXXXQVPIADNTPN 338
              + +      LI +++  EAF V+D L+ G                     +   +    
Sbjct:   271 VKMQTDAGVKLIQEQRWVEAFQVFDSLLNGDLVPYPSYFQNVTGCTNYFNYMQCQEPPDQ 330

Query:   339 TLMVELFNTTTFRKAVHVGNTTYDTSVTEDVFLKNDIMGS 378
                         R+++HVGN T++     +  L  D+M S
Sbjct:   331 EYFSSFVTLPEVRRSIHVGNLTFNDGSDVEKHLLQDVMKS 370
GO:0006508 "proteolysis" evidence=IEA
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA
GO:0004180 "carboxypeptidase activity" evidence=IEA
UNIPROTKB|Q9H3G5 CPVL "Probable serine carboxypeptidase CPVL" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX68 CPVL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0038738 CG4572 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1918537 Cpvl "carboxypeptidase, vitellogenic-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1563609 Cpvl "carboxypeptidase, vitellogenic-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6XKB3 CPVL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZ23 CPVL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XKA5 CPVL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIG3 CPVL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9H3G5CPVL_HUMAN3, ., 4, ., 1, 6, ., -0.38630.76070.7079yesN/A
C9WMM5VCP_APIME3, ., 4, ., 1, 6, ., -0.42700.80810.7665yesN/A
Q9D3S9CPVL_MOUSE3, ., 4, ., 1, 6, ., -0.35420.79230.7343yesN/A
Q4QR71CPVL_RAT3, ., 4, ., 1, 6, ., -0.36230.79230.7343yesN/A
Q5RFE4CPVL_PONAB3, ., 4, ., 1, 6, ., -0.38170.75840.7058yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 1e-58
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 2e-33
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 5e-22
COG2939498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 8e-22
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 2e-19
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 9e-06
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  197 bits (504), Expect = 1e-58
 Identities = 95/331 (28%), Positives = 140/331 (42%), Gaps = 35/331 (10%)

Query: 70  PGF----NIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMT 125
           PG       + YSG+  V+ +  +    +LF+WFF +E  P N P++LWLN G G SS+ 
Sbjct: 1   PGLDGPLPFKQYSGYLTVDESAGR----SLFYWFFESENNPENDPLVLWLNGGPGCSSLG 56

Query: 126 GLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNK 185
           GLF+E GP ++N        PY       W+K  NV+++D PVG GFS++     Y  + 
Sbjct: 57  GLFEELGPFRVNSGPTLYLNPYS------WNKVANVLFLDQPVGVGFSYSNTTSDYKTDD 110

Query: 186 TQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQ-NNPVTDIKINLK 244
            +   + Y  L +FF+ F EY+ N F+I GE+Y G +  +L   I   N   T   INLK
Sbjct: 111 EETAKDNYEFLQKFFEKFPEYKNNPFYIAGESYAGHYVPALAQEILDGNKKGTGPNINLK 170

Query: 245 GFALGNDLTDPLYMMLYS-KYLYQIGLIDDNGRKLFE----YKEKQITDLIFQKKLGEAF 299
           G  +GN LTDP         + Y  GLI D   +  +     K           K     
Sbjct: 171 GVLIGNGLTDPAIQYNSYIPFAYYHGLISDELYESLKKACCGKYPDCDPAN--TKCLNLV 228

Query: 300 DVYDELIVGTFHDKTIYNTLT----NFTNLYNYQVPIADNT----PNTLMVELFNTTTFR 351
           +               YN  T    N +   N     +         + + +  N    R
Sbjct: 229 EEASGCNAYN-GGINPYNIYTPCCYNSSLSLNPSSTDSCGGYDCYDESYVEKYLNRPDVR 287

Query: 352 KAVHVGNTTYDTSV--TEDVF--LKNDIMGS 378
           KA+H    +        ++VF    +DI  S
Sbjct: 288 KALHANKGSVGEWSRCNDEVFNWYGDDISKS 318

Length = 415
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 443
KOG1282|consensus454 100.0
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PLN02209437 serine carboxypeptidase 100.0
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 100.0
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 100.0
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 100.0
KOG1283|consensus414 100.0
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 97.73
TIGR03611257 RutD pyrimidine utilization protein D. This protei 97.67
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 97.55
PHA02857276 monoglyceride lipase; Provisional 97.19
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 97.11
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 96.96
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 96.95
PLN02298330 hydrolase, alpha/beta fold family protein 96.93
PRK10673255 acyl-CoA esterase; Provisional 96.89
PLN02824294 hydrolase, alpha/beta fold family protein 96.85
PLN02385349 hydrolase; alpha/beta fold family protein 96.83
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 96.81
PLN02652395 hydrolase; alpha/beta fold family protein 96.64
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 96.59
PRK00870302 haloalkane dehalogenase; Provisional 96.49
PLN02894402 hydrolase, alpha/beta fold family protein 96.34
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 96.25
PRK10749330 lysophospholipase L2; Provisional 96.21
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 96.21
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 95.98
PRK03204286 haloalkane dehalogenase; Provisional 95.9
PRK03592295 haloalkane dehalogenase; Provisional 95.9
PRK05077414 frsA fermentation/respiration switch protein; Revi 95.88
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 95.52
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 95.07
PLN02679360 hydrolase, alpha/beta fold family protein 94.86
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 94.85
PLN02442283 S-formylglutathione hydrolase 94.83
PRK10349256 carboxylesterase BioH; Provisional 94.8
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 94.79
PLN03084383 alpha/beta hydrolase fold protein; Provisional 94.64
PRK10566249 esterase; Provisional 94.56
KOG1515|consensus336 94.49
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 94.48
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 94.33
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 94.32
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 94.32
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 94.27
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 94.21
PRK05855 582 short chain dehydrogenase; Validated 94.19
PRK10115686 protease 2; Provisional 93.82
KOG4409|consensus365 93.73
PRK08775343 homoserine O-acetyltransferase; Provisional 93.71
PLN02511388 hydrolase 93.68
PLN02211273 methyl indole-3-acetate methyltransferase 93.27
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 93.27
PLN02965255 Probable pheophorbidase 93.01
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 92.95
PRK07581339 hypothetical protein; Validated 92.38
COG2267298 PldB Lysophospholipase [Lipid metabolism] 92.21
PLN02578354 hydrolase 91.82
PRK06489360 hypothetical protein; Provisional 90.88
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 90.85
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 90.84
KOG1455|consensus313 90.81
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 90.01
PRK00175379 metX homoserine O-acetyltransferase; Provisional 89.99
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 89.66
PRK10985324 putative hydrolase; Provisional 89.54
PRK10162318 acetyl esterase; Provisional 88.51
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 88.41
cd00312493 Esterase_lipase Esterases and lipases (includes fu 88.35
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 87.81
PLN00021313 chlorophyllase 87.79
KOG1838|consensus409 87.23
PLN02454414 triacylglycerol lipase 86.2
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 84.77
KOG2100|consensus755 84.28
PF10503220 Esterase_phd: Esterase PHB depolymerase 82.8
>KOG1282|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.7e-89  Score=709.18  Aligned_cols=346  Identities=28%  Similarity=0.461  Sum_probs=285.1

Q ss_pred             hhccCcccC-CC----CCceeEeeEEEeeccCCCCCCceEEEEEeecCCCCCCCCEEEEecCCCCchhhccccccccceE
Q psy3706          61 AKKLSEVKL-PG----FNIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQ  135 (443)
Q Consensus        61 a~~~~~V~~-p~----~~~~~ysGyl~V~~~~~~~~~~~lFfwffes~~~~~~~PlvlWlnGGPG~SSl~G~f~E~GP~~  135 (443)
                      ++..++|.. ||    .++++|||||+|    +++.+++||||||||+++|+++||||||||||||||+.|+|.|+|||+
T Consensus        24 ~~~~~~I~~LPG~~~~~~f~~ysGYv~v----~~~~~~~LFYwf~eS~~~P~~dPlvLWLnGGPGCSSl~G~~~E~GPf~   99 (454)
T KOG1282|consen   24 VDEADLIKSLPGQPGPLPFKQYSGYVTV----NESEGRQLFYWFFESENNPETDPLVLWLNGGPGCSSLGGLFEENGPFR   99 (454)
T ss_pred             cchhhhhhcCCCCCCCCCcccccceEEC----CCCCCceEEEEEEEccCCCCCCCEEEEeCCCCCccchhhhhhhcCCeE
Confidence            445566765 66    369999999999    888899999999999999999999999999999999999999999999


Q ss_pred             EcCCCCCCCCcccccCcCccccCceeeEEecccccccccccCCCccccchhHHHHHHHHHHHHHHHHccccCCCcEEEEe
Q psy3706         136 LNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITG  215 (443)
Q Consensus       136 v~~~~~~~~~~~l~~n~~sW~~~anllyiDqPvGtGfSy~~~~~~~~~~~~~~a~d~~~fL~~Ff~~fpe~~~~~~yi~G  215 (443)
                      |+.|+++     |+.|+||||+.||||||||||||||||+++..++.++++.+|+|+++||++||++||||++|||||+|
T Consensus       100 v~~~G~t-----L~~N~ySWnk~aNiLfLd~PvGvGFSYs~~~~~~~~~D~~~A~d~~~FL~~wf~kfPey~~~~fyI~G  174 (454)
T KOG1282|consen  100 VKYNGKT-----LYLNPYSWNKEANILFLDQPVGVGFSYSNTSSDYKTGDDGTAKDNYEFLQKWFEKFPEYKSNDFYIAG  174 (454)
T ss_pred             EcCCCCc-----ceeCCccccccccEEEEecCCcCCccccCCCCcCcCCcHHHHHHHHHHHHHHHHhChhhcCCCeEEec
Confidence            9988776     99999999999999999999999999999998888999999999999999999999999999999999


Q ss_pred             cccccccchhhhHHHhhcCCC-CcceeeeeeeEecCCccChhhHHH-HHHHHHhcCCCChhhHHHHHHHHHHHHHHHhcc
Q psy3706         216 ETYIGQFGTSLGFNIYQNNPV-TDIKINLKGFALGNDLTDPLYMML-YSKYLYQIGLIDDNGRKLFEYKEKQITDLIFQK  293 (443)
Q Consensus       216 ESYaG~yvP~la~~I~~~n~~-~~~~iNLkGi~IGNG~~dp~~q~~-y~~f~y~~GLId~~~~~~~~~~~~~~~~~i~~~  293 (443)
                      |||||||||+||++|+++|+. .++.|||||++||||++||..|.. +.+|+|.||||++++++.+++.|+.+...+.+.
T Consensus       175 ESYAG~YVP~La~~I~~~N~~~~~~~iNLkG~~IGNg~td~~~~~~~~~~~a~~h~liSde~~~~l~~~C~~~~~~~~~~  254 (454)
T KOG1282|consen  175 ESYAGHYVPALAQEILKGNKKCCKPNINLKGYAIGNGLTDPEIDYNGRIPFAWGHGLISDELYESLKRACDFSSDNYANV  254 (454)
T ss_pred             ccccceehHHHHHHHHhccccccCCcccceEEEecCcccCccccccchhhhhhhcccCCHHHHHHHHHHhccCccccccc
Confidence            999999999999999999975 467899999999999999999999 999999999999999999999999875422221


Q ss_pred             -----CHHHHHHHHHHhhhccCCCcccccccccccccc-C---ccCC-CCCCCCchhHHhhcCcHHHHHHhCCCCc---C
Q psy3706         294 -----KLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLY-N---YQVP-IADNTPNTLMVELFNTTTFRKAVHVGNT---T  360 (443)
Q Consensus       294 -----~~~~a~~~~d~~l~g~~~~~s~f~~~tG~~n~y-n---~~~~-~~dP~~~~~~~~yLN~pdVrkALHV~~~---~  360 (443)
                           .|.++.+.++....+.+..+.++...  |...- .   .+.+ ..+||-..+.++|||+++||+||||+..   .
T Consensus       255 ~~~~~~C~~~~~~~~~~~~~~i~~y~i~~~~--C~~~~~~~~~~~~~~~~~~c~~~~~~~ylN~~~VrkALh~~~~~~~~  332 (454)
T KOG1282|consen  255 DPSNTKCNKAVEEFDSKTTGDIDNYYILTPD--CYPTSYELKKPTDCYGYDPCLSDYAEKYLNRPEVRKALHANKTSIGK  332 (454)
T ss_pred             CCchhHHHHHHHHHHHHHhccCchhhhcchh--hccccccccccccccccCCchhhhHHHhcCCHHHHHHhCCCCCCCCc
Confidence                 23334443332221212222222211  11100 0   0001 0356655566999999999999999865   4


Q ss_pred             ccCChHHHHhhhcCCCCCChHHHHHHHhh-h-ccCC---CCceeEecccchhhHHHHHHHHHhhh
Q psy3706         361 YDTSVTEDVFLKNDIMGSRQFPCITGLLS-F-MKQG---PGVSVSCELSVSSFFSAVARMFLRIF  420 (443)
Q Consensus       361 w~~~~~V~~~l~~D~m~s~v~p~l~~LL~-~-~rVl---Gd~D~~cn~~~~~~~~~~~~~~l~~~  420 (443)
                      |..|+.+...-+.|...+ |+|.+.+++. . +|||   ||+|++||++++++  .|++|.++++
T Consensus       333 W~~Cn~~v~~~~~~~~~s-m~p~~~~~~~~~~~rvliysGD~D~~~p~~gt~~--~i~~L~~~~~  394 (454)
T KOG1282|consen  333 WERCNDEVNYNYNDDIKS-MLPIHKKLIASGGYRVLIYSGDHDLVVPFLGTQA--WIKSLNLSIT  394 (454)
T ss_pred             ccccChhhhcccccCccc-hHHHHHHHhhcCceEEEEEeCCcceeCcchhhHH--HHHhccCccc
Confidence            999877665447788888 9999999998 4 9999   99999999977655  8888886554

>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1283|consensus Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 8e-26
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 2e-25
1wpx_A421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 3e-22
1cpy_A421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 6e-21
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 2e-20
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 3e-20
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 3e-20
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 4e-20
1ac5_A483 Crystal Structure Of Kex1(delta)p, A Prohormone-pro 5e-15
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 7e-12
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure 
Iteration: 1

 Score =  114 bits (286), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 106/190 (55%), Gaps = 21/190 (11%)
Query: 68  KLPGF----NIESYSGFFRVNSTEDKKYSSALFFWFFPAEEYPSNAPVLLWLNAGLGSSS 123
           +LPG     +   YSG+ + +       S  L +WF  +++ P N+PV+LWLN G G SS
Sbjct: 9   RLPGLAKQPSFRQYSGYLKSSG------SKHLHYWFVESQKDPENSPVVLWLNGGPGCSS 62
Query: 124 MTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDLYSR 183
           + GL  E+GP  +  +        +E     W+   NV+Y+++P G GFS+++D   Y+ 
Sbjct: 63  LDGLLTEHGPFLVQPDGVT-----LEYNPYSWNLIANVLYLESPAGVGFSYSDD-KFYAT 116
Query: 184 NKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIYQNNPVTDIKINL 243
           N T+V  + + AL  FF++F EY+ N  F+TGE+Y G +  +L   + Q     D  +NL
Sbjct: 117 NDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQ-----DPSMNL 171
Query: 244 KGFALGNDLT 253
           +G A+GN L+
Sbjct: 172 QGLAVGNGLS 181
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 4e-68
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 2e-65
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 2e-63
1ivy_A452 Human protective protein; carboxypeptidase, serine 3e-60
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 7e-59
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
 Score =  223 bits (571), Expect = 4e-68
 Identities = 80/352 (22%), Positives = 133/352 (37%), Gaps = 45/352 (12%)

Query: 64  LSEVKLPGFNIESYSGFFRVNST---EDKKYSSALFFWFFPAEEYPSNA--PVLLWLNAG 118
           LSEV  P    + ++G   + S    E        FFW F   +   N   P+++WLN G
Sbjct: 17  LSEVPDPSNIPQMHAGHIPLRSEDADEQDSSDLEYFFWKFTNNDSNGNVDRPLIIWLNGG 76

Query: 119 LGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAE-- 176
            G SSM G   E+GP ++N + K      +   +  W    ++++ID P G GFS  +  
Sbjct: 77  PGCSSMDGALVESGPFRVNSDGK------LYLNEGSWISKGDLLFIDQPTGTGFSVEQNK 130

Query: 177 -----DYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIY 231
                D + +  +   V  +    L  +FK+F E       ++GE+Y GQ+       I 
Sbjct: 131 DEGKIDKNKFDEDLEDVTKHFMDFLENYFKIFPEDLTRKIILSGESYAGQYIPFFANAIL 190

Query: 232 QNN---PVTDIKINLKGFALGNDLTDPLYMML-YSKYLYQIGLIDDNGRKLFEYK----- 282
            +N    +     +LK   +GN   DP    L Y  +  +  LID++             
Sbjct: 191 NHNKFSKIDGDTYDLKALLIGNGWIDPNTQSLSYLPFAMEKKLIDESNPNFKHLTNAHEN 250

Query: 283 -----EKQITDLIFQKKLGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVP-----I 332
                    TD        E  ++ + L+  T           +  N+YN+ +       
Sbjct: 251 CQNLINSASTDEAAHFSYQECENILNLLLSYTRESSQKGT--ADCLNMYNFNLKDSYPSC 308

Query: 333 ADNTPNTL--MVELFNTTTFRKAVHVGNTTYD--TSVTEDVF--LKNDIMGS 378
             N P  +  + + F+T     ++H+ +   D     T  V   L N I   
Sbjct: 309 GMNWPKDISFVSKFFSTPGVIDSLHLDSDKIDHWKECTNSVGTKLSNPISKP 360
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query443
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1ivy_A452 Human protective protein; carboxypeptidase, serine 100.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 99.28
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 99.26
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 99.2
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 97.78
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 97.72
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 97.72
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 97.67
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 97.66
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 97.62
3llc_A270 Putative hydrolase; structural genomics, joint cen 97.55
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 97.51
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 97.47
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 97.47
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.45
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 97.45
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.43
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 97.42
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 97.41
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 97.4
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 97.35
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 97.35
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.34
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.33
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 97.31
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 97.31
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 97.29
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 97.26
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.25
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 97.25
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.24
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 97.23
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 97.21
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 97.21
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.21
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 97.2
3h04_A275 Uncharacterized protein; protein with unknown func 97.2
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 97.2
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.19
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.18
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 97.16
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.12
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 97.08
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 97.08
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.08
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 97.07
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.07
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.06
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 97.02
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 97.0
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 97.0
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 96.99
1iup_A282 META-cleavage product hydrolase; aromatic compound 96.98
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 96.96
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 96.95
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 96.94
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 96.94
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 96.92
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 96.9
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 96.9
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 96.88
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 96.87
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 96.86
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 96.84
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.81
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 96.8
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 96.8
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 96.79
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 96.79
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 96.77
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 96.75
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.74
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 96.72
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 96.71
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 96.69
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 96.69
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 96.67
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.67
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 96.66
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.66
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.66
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 96.64
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 96.62
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 96.6
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 96.6
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.6
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 96.6
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 96.6
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 96.6
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 96.6
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.59
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 96.58
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 96.55
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 96.48
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 96.47
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 96.46
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 96.44
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 96.43
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 96.43
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 96.39
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 96.38
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 96.35
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 96.33
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 96.33
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 96.31
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 96.29
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 96.26
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 96.26
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.23
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 96.21
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 96.21
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 96.19
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 96.19
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 96.18
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.17
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.15
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 96.14
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 96.13
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 96.12
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 96.1
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.08
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 96.07
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.02
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 95.99
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 95.98
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 95.98
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 95.97
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 95.94
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 95.93
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 94.84
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 95.84
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 95.82
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 95.78
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 95.78
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 95.76
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 95.74
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 95.72
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 95.69
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 95.66
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 95.65
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 95.65
1r3d_A264 Conserved hypothetical protein VC1974; structural 95.64
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 95.63
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 95.47
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 95.41
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 95.38
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 95.35
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 95.32
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 95.28
1vkh_A273 Putative serine hydrolase; structural genomics, jo 95.26
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 95.26
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 95.18
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 95.14
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 95.13
3ain_A323 303AA long hypothetical esterase; carboxylesterase 95.09
3nuz_A398 Putative acetyl xylan esterase; structural genomic 95.03
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 94.98
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 94.98
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 94.92
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 94.87
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 94.87
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 94.8
3bjr_A283 Putative carboxylesterase; structural genomics, jo 94.71
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 94.62
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 94.57
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 94.52
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 94.47
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 94.38
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 94.38
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 94.36
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 94.04
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 93.62
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 93.6
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 93.42
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 93.38
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 93.29
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 93.13
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 92.99
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 92.99
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 92.7
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 92.51
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 92.26
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 91.99
3tej_A329 Enterobactin synthase component F; nonribosomal pe 91.93
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 91.45
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 91.33
1kez_A300 Erythronolide synthase; polyketide synthase, modul 91.14
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 91.07
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 90.87
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 90.79
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 90.58
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 90.58
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 90.27
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 89.63
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 89.41
3d59_A383 Platelet-activating factor acetylhydrolase; secret 89.31
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 89.31
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 88.98
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 88.92
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 88.85
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 88.72
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 88.7
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 88.62
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 88.26
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 88.12
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 88.09
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 87.45
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 87.38
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 87.1
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 87.04
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 87.02
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 86.98
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 86.86
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 83.91
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 83.87
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 81.64
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 81.1
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 80.11
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
Probab=100.00  E-value=6.8e-78  Score=634.73  Aligned_cols=328  Identities=22%  Similarity=0.398  Sum_probs=272.0

Q ss_pred             CceeEeeEEEeeccCCCCC-------CceEEEEEeecC--CCCCCCCEEEEecCCCCchhhccccccccceEEcCCCCCC
Q psy3706          73 NIESYSGFFRVNSTEDKKY-------SSALFFWFFPAE--EYPSNAPVLLWLNAGLGSSSMTGLFQENGPLQLNKNKKRQ  143 (443)
Q Consensus        73 ~~~~ysGyl~V~~~~~~~~-------~~~lFfwffes~--~~~~~~PlvlWlnGGPG~SSl~G~f~E~GP~~v~~~~~~~  143 (443)
                      .+++|||||+|    +++.       +++|||||||++  ++|+++||+||||||||||||.|+|.|+|||+++.+++  
T Consensus        26 ~~~~~aG~~~v----~~~~~~~~~~~~~~lfy~~~~~~~~~~~~~~Pl~lwlnGGPG~SS~~g~~~e~GP~~~~~~~~--   99 (483)
T 1ac5_A           26 IPQMHAGHIPL----RSEDADEQDSSDLEYFFWKFTNNDSNGNVDRPLIIWLNGGPGCSSMDGALVESGPFRVNSDGK--   99 (483)
T ss_dssp             SCEEEEEEEEC----SCSSSCSSCCCCCEEEEEEEECSCSGGGSSCCEEEEECCTTTBCTHHHHHHSSSSEEECTTSC--
T ss_pred             CceeEEEEEec----CccccccccCCCceEEEEEEEecCCCCCcCCCEEEEECCCCchHhhhhhHhhcCCeEecCCCc--
Confidence            35899999999    5443       789999999998  78999999999999999999999999999999998876  


Q ss_pred             CCcccccCcCccccCceeeEEecccccccccccCCCc-------cccchhHHHHHHHHHHHHHHHHccccCCCcEEEEec
Q psy3706         144 PLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAEDYDL-------YSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGE  216 (443)
Q Consensus       144 ~~~~l~~n~~sW~~~anllyiDqPvGtGfSy~~~~~~-------~~~~~~~~a~d~~~fL~~Ff~~fpe~~~~~~yi~GE  216 (443)
                          ++.||+||++.+|||||||||||||||+....+       +.++++++|+++++||++||++||+|++++|||+||
T Consensus       100 ----l~~n~~sw~~~~n~lfiDqPvGtGfSy~~~~~~~~~~~~~~~~~~~~~a~~~~~fl~~~~~~fP~~~~~~~~i~Ge  175 (483)
T 1ac5_A          100 ----LYLNEGSWISKGDLLFIDQPTGTGFSVEQNKDEGKIDKNKFDEDLEDVTKHFMDFLENYFKIFPEDLTRKIILSGE  175 (483)
T ss_dssp             ----EEECTTCGGGTSEEEEECCSTTSTTCSSCCSSGGGSCTTSSCCSHHHHHHHHHHHHHHHHHHCTTGGGSEEEEEEE
T ss_pred             ----eeecccchhhcCCeEEEecCCCccccCCcCcccccccccccCCCHHHHHHHHHHHHHHHHHhChhhcCCCEEEEec
Confidence                999999999999999999999999999876543       677899999999999999999999999999999999


Q ss_pred             ccccccchhhhHHHhhcCCC---CcceeeeeeeEecCCccChhhHHH-HHHHHHhcCCCChhh--HHHHHHHHHHHHHHH
Q psy3706         217 TYIGQFGTSLGFNIYQNNPV---TDIKINLKGFALGNDLTDPLYMML-YSKYLYQIGLIDDNG--RKLFEYKEKQITDLI  290 (443)
Q Consensus       217 SYaG~yvP~la~~I~~~n~~---~~~~iNLkGi~IGNG~~dp~~q~~-y~~f~y~~GLId~~~--~~~~~~~~~~~~~~i  290 (443)
                      ||||||||+||++|+++|+.   .+++||||||+||||++||..|.. |.+|+|++|||++++  ++.+++....|.+.+
T Consensus       176 SYgg~y~p~~a~~i~~~n~~~~~~~~~inLkGi~IGNg~~d~~~~~~~~~~f~~~~gli~~~~~~~~~~~~~~~~C~~~i  255 (483)
T 1ac5_A          176 SYAGQYIPFFANAILNHNKFSKIDGDTYDLKALLIGNGWIDPNTQSLSYLPFAMEKKLIDESNPNFKHLTNAHENCQNLI  255 (483)
T ss_dssp             ETHHHHHHHHHHHHHHHHHHCCSTTSCCEEEEEEEEEECCCHHHHHTTHHHHHHHTTSCCTTSTTHHHHHHHHHHHHHHH
T ss_pred             cccccccHHHHHHHHHhcccccccCcccceeeeEecCCcccchhhhccHHHHHHhCCCCCccHHHHHHHHHHHHHHHHHH
Confidence            99999999999999998753   246799999999999999999999 999999999999986  788877777777776


Q ss_pred             hccC--------HHHHHHHHHHhhhccCCCccccccccccccccCccC-CCCCCCC------chhHHhhcCcHHHHHHhC
Q psy3706         291 FQKK--------LGEAFDVYDELIVGTFHDKTIYNTLTNFTNLYNYQV-PIADNTP------NTLMVELFNTTTFRKAVH  355 (443)
Q Consensus       291 ~~~~--------~~~a~~~~d~~l~g~~~~~s~f~~~tG~~n~yn~~~-~~~dP~~------~~~~~~yLN~pdVrkALH  355 (443)
                      .++.        +.+|.++++.++... ..... ....+|.+.||++. |..++|.      ..++..|||+++||+|||
T Consensus       256 ~~~~~~~~~~~~~~~C~~~~~~~~~~~-~~~~~-~~~~~c~n~ydi~~~~~~~~c~~~~~~~~~~~~~ylN~~~Vq~ALh  333 (483)
T 1ac5_A          256 NSASTDEAAHFSYQECENILNLLLSYT-RESSQ-KGTADCLNMYNFNLKDSYPSCGMNWPKDISFVSKFFSTPGVIDSLH  333 (483)
T ss_dssp             HHCCSGGGGSSSCHHHHTHHHHHHHHT-CCCCT-TSTTSEEETTEEEEEECTTTTTTTCCTHHHHHHHHHTSTTHHHHTT
T ss_pred             HhccccccccccHHHHHHHHHHHHHHh-hcccc-cccccCcccccccccCCCCCcccccccchhHHHHHhCCHHHHHHhC
Confidence            5432        234555555543211 00000 11356788898875 2122342      246899999999999999


Q ss_pred             CCCc---CccCC-hHHHHhhhcCCCCCChHHHHHHHhhh-ccCC---CCceeEecccchhhHHHHHHH
Q psy3706         356 VGNT---TYDTS-VTEDVFLKNDIMGSRQFPCITGLLSF-MKQG---PGVSVSCELSVSSFFSAVARM  415 (443)
Q Consensus       356 V~~~---~w~~~-~~V~~~l~~D~m~s~v~p~l~~LL~~-~rVl---Gd~D~~cn~~~~~~~~~~~~~  415 (443)
                      |+..   +|+.| ..|..++..|.|++ +++.+++||++ +|||   ||.|++|||+++..  .+++|
T Consensus       334 v~~~~~~~w~~Cs~~V~~~~~~d~~~~-~~~~l~~LL~~girVLIYsGD~D~icn~~Gt~~--~i~~L  398 (483)
T 1ac5_A          334 LDSDKIDHWKECTNSVGTKLSNPISKP-SIHLLPGLLESGIEIVLFNGDKDLICNNKGVLD--TIDNL  398 (483)
T ss_dssp             CCTTTCCCCCSBCHHHHHHCCCSSCCC-GGGGHHHHHHTTCEEEEEEETTCSTTCHHHHHH--HHHHC
T ss_pred             CCCCCCCCeeeCchhHHHHhcCCCcCc-HHHHHHHHHhcCceEEEEECCcCcccCcHHHHH--HHHhc
Confidence            9864   69984 56777788899999 99999999995 9999   99999999966443  44444
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 443
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 1e-48
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 1e-47
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 2e-46
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 4e-45
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 4e-44
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Serine carboxypeptidase-like
domain: Serine carboxypeptidase II
species: Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]

 Score =  171 bits (433), Expect = 1e-48
 Identities = 79/350 (22%), Positives = 129/350 (36%), Gaps = 41/350 (11%)

Query: 64  LSEVKLPGFNIESYSGFFRVNST---EDKKYSSALFFWFFPAEEYPSNA--PVLLWLNAG 118
           LSEV  P    + ++G   + S    E        FFW F   +   N   P+++WLN G
Sbjct: 17  LSEVPDPSNIPQMHAGHIPLRSEDADEQDSSDLEYFFWKFTNNDSNGNVDRPLIIWLNGG 76

Query: 119 LGSSSMTGLFQENGPLQLNKNKKRQPLPYVEKRKTYWSKNHNVIYIDNPVGRGFSFAE-- 176
            G SSM G   E+GP ++N + K             W    ++++ID P G GFS  +  
Sbjct: 77  PGCSSMDGALVESGPFRVNSDGKLYLNEG------SWISKGDLLFIDQPTGTGFSVEQNK 130

Query: 177 -----DYDLYSRNKTQVGLNLYIALVQFFKVFNEYQRNDFFITGETYIGQFGTSLGFNIY 231
                D + +  +   V  +    L  +FK+F E       ++GE+Y GQ+       I 
Sbjct: 131 DEGKIDKNKFDEDLEDVTKHFMDFLENYFKIFPEDLTRKIILSGESYAGQYIPFFANAIL 190

Query: 232 QNNPVTDIK---INLKGFALGNDLTDPLYMML-YSKYLYQIGLIDDNGRKLFEYKE--KQ 285
            +N  + I     +LK   +GN   DP    L Y  +  +  LID++           + 
Sbjct: 191 NHNKFSKIDGDTYDLKALLIGNGWIDPNTQSLSYLPFAMEKKLIDESNPNFKHLTNAHEN 250

Query: 286 ITDLIFQKKLGEA-----------FDVYDELIVGTFHDKTIYNTLTNFTNLYNYQVPIAD 334
             +LI      EA            ++       +    T         NL +       
Sbjct: 251 CQNLINSASTDEAAHFSYQECENILNLLLSYTRESSQKGTADCLNMYNFNLKDSYPSCGM 310

Query: 335 NTPNTL--MVELFNTTTFRKAVHVGNTT--YDTSVTEDVF--LKNDIMGS 378
           N P  +  + + F+T     ++H+ +    +    T  V   L N I   
Sbjct: 311 NWPKDISFVSKFFSTPGVIDSLHLDSDKIDHWKECTNSVGTKLSNPISKP 360
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure