Diaphorina citri psyllid: psy3711


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MYSLAKFAASPAARSALISSARMTAMRPLSSSITSTSAFTQQTTPQTQQISILPAVRQFQTSAVSRDIDSAAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFSLMMAFLLLFAF
ccccHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MYSLAKFAASPAARSALISSARMTAM*******************************QF*TSAVSRDIDSAAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFSLMMAFLLLFAF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSLAKFAASPAARSALISSARMTAMRPLSSSITSTSAFTQQTTPQTQQISILPAVRQFQTSAVSRDIDSAAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFSLMMAFLLLFAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP synthase lipid-binding protein, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.very confidentP07926
ATP synthase lipid-binding protein, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.very confidentP56384
ATP synthase lipid-binding protein, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.very confidentQ5RFL2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046034 [BP]ATP metabolic processprobableGO:0009141, GO:0009144, GO:0034641, GO:0006807, GO:0044237, GO:0072521, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0071704, GO:0009199, GO:0009205, GO:0009987, GO:0006725, GO:0009150, GO:0009117, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0000276 [CC]mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)probableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0045263, GO:0031090, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0005753, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0019866, GO:0045259, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0044429, GO:0044424, GO:0044425, GO:0016469, GO:0044422, GO:0033177
GO:0045471 [BP]response to ethanolprobableGO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XND, chain J
Confidence level:very confident
Coverage over the Query: 69-139
View the alignment between query and template
View the model in PyMOL