Diaphorina citri psyllid: psy3712


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYLY
ccccEEEEECccccEEEEECcccccEEEEEEEccccEEEEEcccccccccccEEEEEEcccccEEEEEEccccEEEEEEcccEEEEEEccEEEEEEcccccEEEEEECc
MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat domain phosphoinositide-interacting protein 3 confidentQ5R7W0
WD repeat domain phosphoinositide-interacting protein 3 confidentQ9CR39
WD repeat domain phosphoinositide-interacting protein 3 confidentQ5ZL16

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0080025 [MF]phosphatidylinositol-3,5-bisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0000045 [BP]autophagic vacuole assemblyprobableGO:0009991, GO:0022607, GO:0008152, GO:0016236, GO:0044248, GO:0042594, GO:0044699, GO:0051716, GO:0016043, GO:0071840, GO:0071496, GO:0006914, GO:0009987, GO:0006950, GO:0044763, GO:0009267, GO:0007154, GO:0070925, GO:0009056, GO:0006996, GO:0007033, GO:0031668, GO:0031669, GO:0009605, GO:0050896, GO:0031667, GO:0044237, GO:0044085, GO:0033554, GO:0008150
GO:0032266 [MF]phosphatidylinositol-3-phosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VU4, chain A
Confidence level:very confident
Coverage over the Query: 1-106
View the alignment between query and template
View the model in PyMOL