Psyllid ID: psy3712

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYLY
ccccEEEEEEccccEEEEEEcccccEEEEEEEccccEEEEEcccccccccccEEEEEEcccccEEEEEEccccEEEEEEcccEEEEEEccEEEEEEcccccEEEEEEEc
ccccEEEEEcccHHHHHccccccccHHHHHHHHHccEEEEEcccccccccccEEEEEEcccccEEEEEEEcccEEEEEEcccEEEEEEEcEEEEEEccccHHHHHHHcc
medgfriyncdplkekerqdftdgglghVEMLFRCNYLalvgggthpkypnnrvmIWDDLKKQVVICLefnapvkgvrlrRDKIVVVLEGLIKVYTfiqcpqqlhiyly
medgfriyncdplkekerqDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEfnapvkgvrlrrDKIVVVLEGLIKvytfiqcpqQLHIYLY
MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYLY
*****RIYNCDP*******DFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYL*
MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYLY
MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYLY
**DGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYLY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIYLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q5ZL16 344 WD repeat domain phosphoi yes N/A 0.981 0.311 0.700 3e-44
Q5R7W0 344 WD repeat domain phosphoi yes N/A 0.981 0.311 0.700 5e-44
Q9CR39 344 WD repeat domain phosphoi yes N/A 0.981 0.311 0.700 5e-44
Q5MNZ6 344 WD repeat domain phosphoi yes N/A 0.981 0.311 0.700 5e-44
Q7ZUW6 344 WD repeat domain phosphoi yes N/A 0.981 0.311 0.691 2e-43
Q640T2 344 WD repeat domain phosphoi yes N/A 0.981 0.311 0.691 2e-43
Q68F45 344 WD repeat domain phosphoi N/A N/A 0.981 0.311 0.682 1e-42
Q6CEI9 359 SVP1-like protein 2 OS=Ya yes N/A 0.926 0.281 0.495 9e-26
Q5QA93 360 SVP1-like protein 2 OS=Pi N/A N/A 0.944 0.286 0.471 2e-22
Q6DCV0 355 WD repeat domain phosphoi N/A N/A 0.954 0.292 0.5 5e-22
>sp|Q5ZL16|WIPI3_CHICK WD repeat domain phosphoinositide-interacting protein 3 OS=Gallus gallus GN=WDR45B PE=2 SV=1 Back     alignment and function desciption
 Score =  176 bits (447), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 92/107 (85%)

Query: 1   MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDL 60
           ME+GFR+YN DPLKEKE+Q+F +GG+GHVEMLFRCNYLALVGGG  PKYP N+VMIWDDL
Sbjct: 29  MENGFRVYNADPLKEKEKQEFPEGGVGHVEMLFRCNYLALVGGGKKPKYPPNKVMIWDDL 88

Query: 61  KKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIY 107
           KK+ VI +EF+  VK V+LRRD+IVVVL+ +IKV+TF   P QLH++
Sbjct: 89  KKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMIKVFTFTHNPHQLHVF 135

Gallus gallus (taxid: 9031)
>sp|Q5R7W0|WIPI3_PONAB WD repeat domain phosphoinositide-interacting protein 3 OS=Pongo abelii GN=WDR45B PE=2 SV=1 Back     alignment and function description
>sp|Q9CR39|WIPI3_MOUSE WD repeat domain phosphoinositide-interacting protein 3 OS=Mus musculus GN=Wdr45b PE=2 SV=2 Back     alignment and function description
>sp|Q5MNZ6|WIPI3_HUMAN WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens GN=WDR45B PE=2 SV=2 Back     alignment and function description
>sp|Q7ZUW6|WIPI3_DANRE WD repeat domain phosphoinositide-interacting protein 3 OS=Danio rerio GN=wdr45b PE=2 SV=1 Back     alignment and function description
>sp|Q640T2|WIPI3_XENTR WD repeat domain phosphoinositide-interacting protein 3 OS=Xenopus tropicalis GN=wdr45b PE=2 SV=1 Back     alignment and function description
>sp|Q68F45|WIPI3_XENLA WD repeat domain phosphoinositide-interacting protein 3 OS=Xenopus laevis GN=wdr45b PE=2 SV=1 Back     alignment and function description
>sp|Q6CEI9|HSV2_YARLI SVP1-like protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSV2 PE=3 SV=1 Back     alignment and function description
>sp|Q5QA93|HSV2_PICAN SVP1-like protein 2 OS=Pichia angusta GN=HSV2 PE=3 SV=1 Back     alignment and function description
>sp|Q6DCV0|WIPI4_XENLA WD repeat domain phosphoinositide-interacting protein 4 OS=Xenopus laevis GN=wdr45 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
242013704 345 WD repeat domain phosphoinositide-intera 0.981 0.310 0.831 2e-50
307202660 344 WD repeat domain phosphoinositide-intera 0.981 0.311 0.803 6e-49
332027856 344 WD repeat domain phosphoinositide-intera 0.981 0.311 0.794 2e-48
322779446 349 hypothetical protein SINV_02152 [Solenop 0.981 0.306 0.794 2e-48
307168371 344 WD repeat domain phosphoinositide-intera 0.981 0.311 0.785 2e-47
156549567 342 PREDICTED: WD repeat domain phosphoinosi 0.981 0.312 0.766 2e-47
156365815 344 predicted protein [Nematostella vectensi 0.981 0.311 0.775 3e-47
72170536 348 PREDICTED: WD repeat domain phosphoinosi 0.981 0.307 0.766 9e-47
427785221 348 Hypothetical protein [Rhipicephalus pulc 0.981 0.307 0.766 1e-45
340720893 343 PREDICTED: WD repeat domain phosphoinosi 0.972 0.309 0.766 2e-45
>gi|242013704|ref|XP_002427542.1| WD repeat domain phosphoinositide-interacting protein, putative [Pediculus humanus corporis] gi|212511944|gb|EEB14804.1| WD repeat domain phosphoinositide-interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  202 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/107 (83%), Positives = 97/107 (90%)

Query: 1   MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDL 60
           ME+GFR+YNCDPLKEKERQDF DGGL +VEMLFRCNYLALVGGG  PKYP NRVM+WDDL
Sbjct: 29  MENGFRVYNCDPLKEKERQDFVDGGLSYVEMLFRCNYLALVGGGPCPKYPPNRVMVWDDL 88

Query: 61  KKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIY 107
           KKQ VI LEFNAPVK VRLRRD+IVVVLEG+IKVYTF Q PQQLH++
Sbjct: 89  KKQTVIALEFNAPVKAVRLRRDRIVVVLEGVIKVYTFTQHPQQLHVF 135

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307202660|gb|EFN81980.1| WD repeat domain phosphoinositide-interacting protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332027856|gb|EGI67914.1| WD repeat domain phosphoinositide-interacting protein 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322779446|gb|EFZ09638.1| hypothetical protein SINV_02152 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307168371|gb|EFN61554.1| WD repeat domain phosphoinositide-interacting protein 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|156549567|ref|XP_001607565.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156365815|ref|XP_001626838.1| predicted protein [Nematostella vectensis] gi|156213729|gb|EDO34738.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|72170536|ref|XP_792976.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 3-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|427785221|gb|JAA58062.1| Hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|340720893|ref|XP_003398863.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 3-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
FB|FBgn0037648 340 CG11975 [Drosophila melanogast 0.972 0.311 0.726 2.6e-40
UNIPROTKB|Q5ZL16 344 WDR45B "WD repeat domain phosp 0.981 0.311 0.700 1.8e-39
UNIPROTKB|Q5MNZ6 344 WDR45B "WD repeat domain phosp 0.981 0.311 0.700 2.3e-39
MGI|MGI:1914090 344 Wdr45b "WD repeat domain 45B" 0.981 0.311 0.700 2.3e-39
RGD|1305141 344 Wdr45b "WD repeat domain 45B" 0.981 0.311 0.700 2.3e-39
ZFIN|ZDB-GENE-040426-863 344 wdr45l "wdr45 like" [Danio rer 0.981 0.311 0.691 7.8e-39
UNIPROTKB|Q640T2 344 wdr45b "WD repeat domain phosp 0.981 0.311 0.691 9.9e-39
DICTYBASE|DDB_G0282581 350 wdr45l "WD repeat domain phosp 0.935 0.291 0.552 2.2e-25
UNIPROTKB|Q8LR61 457 P0423A12.30 "Putative WD repea 0.880 0.210 0.575 5.7e-25
TAIR|locus:2081705 425 AtATG18a "autophagy 18a" [Arab 0.862 0.221 0.6 1.6e-24
FB|FBgn0037648 CG11975 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 429 (156.1 bits), Expect = 2.6e-40, P = 2.6e-40
 Identities = 77/106 (72%), Positives = 90/106 (84%)

Query:     2 EDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLK 61
             + GFR+YNCDPLKEKERQ F +GGL HVEMLFRCNYLALVGGG  P YP N+V++WDDLK
Sbjct:    30 DTGFRVYNCDPLKEKERQYFPEGGLSHVEMLFRCNYLALVGGGIRPLYPPNKVIVWDDLK 89

Query:    62 KQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHIY 107
             K   I L+FN PV+ VRLRRD+IVVVLEG+IKV+TF Q PQQLH++
Sbjct:    90 KSPAISLDFNQPVRAVRLRRDRIVVVLEGVIKVFTFTQQPQQLHVF 135
GO:0080025 "phosphatidylinositol-3,5-bisphosphate binding" evidence=IBA
GO:0000045 "autophagic vacuole assembly" evidence=IBA
GO:0032266 "phosphatidylinositol-3-phosphate binding" evidence=IBA
GO:0005737 "cytoplasm" evidence=IBA
UNIPROTKB|Q5ZL16 WDR45B "WD repeat domain phosphoinositide-interacting protein 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5MNZ6 WDR45B "WD repeat domain phosphoinositide-interacting protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914090 Wdr45b "WD repeat domain 45B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305141 Wdr45b "WD repeat domain 45B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-863 wdr45l "wdr45 like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q640T2 wdr45b "WD repeat domain phosphoinositide-interacting protein 3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282581 wdr45l "WD repeat domain phosphoinositide-interacting protein 3" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q8LR61 P0423A12.30 "Putative WD repeat domain 45" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2081705 AtATG18a "autophagy 18a" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7ZUW6WIPI3_DANRENo assigned EC number0.69150.98160.3110yesN/A
Q5MNZ6WIPI3_HUMANNo assigned EC number0.70090.98160.3110yesN/A
Q640T2WIPI3_XENTRNo assigned EC number0.69150.98160.3110yesN/A
Q9CR39WIPI3_MOUSENo assigned EC number0.70090.98160.3110yesN/A
Q5ZL16WIPI3_CHICKNo assigned EC number0.70090.98160.3110yesN/A
Q5B464HSV2_EMENINo assigned EC number0.50640.70640.2429yesN/A
Q5R7W0WIPI3_PONABNo assigned EC number0.70090.98160.3110yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG2111|consensus 346 100.0
KOG2110|consensus 391 99.96
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 97.64
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.43
KOG0647|consensus 347 97.32
KOG0305|consensus484 97.0
KOG1036|consensus 323 96.91
KOG0310|consensus 487 96.84
KOG0278|consensus 334 96.71
KOG1645|consensus463 96.61
PTZ00420 568 coronin; Provisional 96.31
PF09826 521 Beta_propel: Beta propeller domain; InterPro: IPR0 96.27
KOG0274|consensus 537 96.25
PTZ00421 493 coronin; Provisional 96.04
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.01
KOG0643|consensus 327 96.0
KOG0274|consensus 537 95.98
PLN00181 793 protein SPA1-RELATED; Provisional 95.8
KOG0279|consensus315 95.65
PTZ00421 493 coronin; Provisional 95.3
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.11
PTZ00420 568 coronin; Provisional 95.06
KOG0306|consensus 888 94.9
KOG0289|consensus506 94.58
KOG0266|consensus456 94.4
PF08366105 LLGL: LLGL2; InterPro: IPR013577 This domain is fo 94.15
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.13
KOG0281|consensus 499 93.94
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.87
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.83
KOG0291|consensus 893 93.71
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.54
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 93.35
KOG0284|consensus 464 93.28
KOG0276|consensus 794 93.08
KOG0308|consensus 735 93.06
KOG0315|consensus 311 93.05
KOG0266|consensus 456 93.04
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 92.75
KOG1407|consensus 313 92.61
KOG0318|consensus 603 92.54
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 92.43
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 92.2
KOG1408|consensus 1080 91.94
KOG2321|consensus 703 91.92
KOG0291|consensus 893 91.9
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 91.41
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 91.29
KOG0302|consensus440 90.98
KOG0310|consensus 487 90.75
PF14727 418 PHTB1_N: PTHB1 N-terminus 90.58
KOG0281|consensus499 90.55
KOG3881|consensus412 90.44
KOG0294|consensus 362 90.28
KOG0300|consensus481 90.27
KOG0273|consensus 524 89.75
KOG0303|consensus 472 89.6
KOG0278|consensus334 89.41
KOG0263|consensus707 89.36
KOG1272|consensus 545 89.24
KOG1273|consensus 405 89.14
PLN00181793 protein SPA1-RELATED; Provisional 89.1
KOG2110|consensus 391 87.92
KOG0318|consensus 603 87.73
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 86.76
KOG1539|consensus 910 86.47
KOG0268|consensus 433 84.42
KOG0294|consensus 362 84.05
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 83.91
KOG1274|consensus 933 83.78
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 83.42
KOG0272|consensus459 82.86
KOG0265|consensus 338 82.15
KOG2055|consensus 514 81.65
KOG0315|consensus 311 81.41
KOG0276|consensus 794 81.1
>KOG2111|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.5e-42  Score=264.98  Aligned_cols=108  Identities=61%  Similarity=1.089  Sum_probs=104.8

Q ss_pred             CCcceEEEeecCCceeeeeecCCCCEEEEEEcCCccEEEEEcCCCCCCCCCceEEEEeCCCCcEEEEEEccCceeEEEec
Q psy3712           1 MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLR   80 (109)
Q Consensus         1 ~~~Gf~Iy~~~P~~~~~~~~~~~g~v~~veml~~tn~ialVg~g~~p~~~~n~v~IwDd~~~~~i~el~f~s~V~~V~l~   80 (109)
                      |++|||||||+||++..++++..||++++|||||||++||||||.+|+||||||+||||.+++.+.|++|.++|++|+|+
T Consensus        24 ~~~Gfriyn~~P~ke~~~r~~~~~G~~~veMLfR~N~laLVGGg~~pky~pNkviIWDD~k~~~i~el~f~~~I~~V~l~  103 (346)
T KOG2111|consen   24 TDTGFRIYNCDPFKESASRQFIDGGFKIVEMLFRSNYLALVGGGSRPKYPPNKVIIWDDLKERCIIELSFNSEIKAVKLR  103 (346)
T ss_pred             ecCceEEEecCchhhhhhhccccCchhhhhHhhhhceEEEecCCCCCCCCCceEEEEecccCcEEEEEEeccceeeEEEc
Confidence            68999999999999988888888999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEEEEeCCeEEEEEcCCCCEEeEEec
Q psy3712          81 RDKIVVVLEGLIKVYTFIQCPQQLHIYL  108 (109)
Q Consensus        81 r~~lvVvl~~~i~vy~~~~~~~ll~~~~  108 (109)
                      |+||||||+++|+||+|+++|+++|.+.
T Consensus       104 r~riVvvl~~~I~VytF~~n~k~l~~~e  131 (346)
T KOG2111|consen  104 RDRIVVVLENKIYVYTFPDNPKLLHVIE  131 (346)
T ss_pred             CCeEEEEecCeEEEEEcCCChhheeeee
Confidence            9999999999999999999999999874

>KOG2110|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF09826 Beta_propel: Beta propeller domain; InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PF08366 LLGL: LLGL2; InterPro: IPR013577 This domain is found in lethal giant larvae homologue 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn [] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3vu4_A 355 Crystal Structure Of Kluyvelomyces Marxianus Hsv2 L 4e-09
4av8_A 339 Kluyveromyces Lactis Hsv2 Complete Loop 6cd Length 7e-09
>pdb|3VU4|A Chain A, Crystal Structure Of Kluyvelomyces Marxianus Hsv2 Length = 355 Back     alignment and structure 
Iteration: 1

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 37/93 (39%), Positives = 48/93 (51%), Gaps = 8/93 (8%)
Query: 5   FRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQV 64
           F IYN  P+     Q+     L  V ML R NY+A V G          V IWDD+KKQ 
Sbjct: 42  FEIYNVHPVAHIMSQEMRH--LSKVRMLHRTNYVAFVTG------VKEVVHIWDDVKKQD 93
Query: 65  VICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTF 97
           V  ++ +APVK + L R+ IVV    +I V+ F
Sbjct: 94  VSRIKVDAPVKDLFLSREFIVVSYGDVISVFKF 126
>pdb|4AV8|A Chain A, Kluyveromyces Lactis Hsv2 Complete Loop 6cd Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 4e-32
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
 Score =  114 bits (286), Expect = 4e-32
 Identities = 37/106 (34%), Positives = 51/106 (48%), Gaps = 8/106 (7%)

Query: 1   MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDL 60
               F IYN  P+     Q+     L  V ML R NY+A V G          V IWDD+
Sbjct: 38  TLKSFEIYNVHPVAHIMSQEM--RHLSKVRMLHRTNYVAFVTGV------KEVVHIWDDV 89

Query: 61  KKQVVICLEFNAPVKGVRLRRDKIVVVLEGLIKVYTFIQCPQQLHI 106
           KKQ V  ++ +APVK + L R+ IVV    +I V+ F    +++  
Sbjct: 90  KKQDVSRIKVDAPVKDLFLSREFIVVSYGDVISVFKFGNPWKRITD 135

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 99.54
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.64
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.61
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.58
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.53
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.52
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 97.43
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.42
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.39
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.37
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.36
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.36
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 97.35
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 97.35
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.35
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 97.31
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.28
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.27
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.27
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.23
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.23
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.22
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.22
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 97.2
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 97.19
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 97.17
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.15
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.14
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.11
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.11
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 97.1
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 97.1
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.1
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.08
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.06
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 97.06
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 97.01
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.99
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.99
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.99
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.97
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.96
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.95
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 96.92
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.89
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 96.89
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.88
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.84
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.73
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.72
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 96.7
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.67
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.64
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.64
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 96.6
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 96.54
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 96.53
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.51
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 96.51
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.48
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.48
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 96.45
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.4
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 96.38
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.36
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.34
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.34
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 96.34
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.27
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.26
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.24
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.11
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.1
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.08
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.07
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.06
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.06
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.06
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 95.98
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.94
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.9
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.88
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 95.86
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.84
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 95.8
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 95.75
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 95.74
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.72
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 95.72
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.54
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.53
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.53
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.51
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.51
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 95.4
3jro_A 753 Fusion protein of protein transport protein SEC13 95.39
3jrp_A 379 Fusion protein of protein transport protein SEC13 95.22
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.14
2ymu_A577 WD-40 repeat protein; unknown function, two domain 95.06
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.02
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.99
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 94.8
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.8
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 94.75
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 94.65
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 94.65
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 94.6
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 94.59
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.53
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 94.39
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 94.38
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 94.2
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.03
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 93.91
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.79
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 93.77
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 93.74
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.58
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 93.5
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 93.41
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 93.36
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 92.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 92.94
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 92.89
2pm7_B 297 Protein transport protein SEC13, protein transport 92.76
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.73
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 92.47
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 92.36
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 91.96
3jro_A 753 Fusion protein of protein transport protein SEC13 91.86
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 91.66
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 91.41
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 91.32
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 91.22
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 91.08
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 90.84
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 90.42
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 90.25
2xzh_A 365 Clathrin heavy chain 1; endocytosis, endocytosis i 90.19
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 89.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 89.78
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 89.43
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 89.35
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 89.14
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 88.98
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 88.58
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 88.26
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 88.1
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 87.5
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 87.2
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 86.95
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 86.81
2pm7_B297 Protein transport protein SEC13, protein transport 86.54
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 86.21
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 86.19
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 85.96
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 85.06
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 84.73
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 84.33
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 83.09
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 81.61
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 81.6
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 81.2
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 81.07
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 80.72
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 80.55
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
Probab=99.54  E-value=1.2e-13  Score=103.93  Aligned_cols=98  Identities=38%  Similarity=0.549  Sum_probs=86.9

Q ss_pred             CCcceEEEeecCCceeeeeecCCCCEEEEEEcCCccEEEEEcCCCCCCCCCceEEEEeCCCCcEEEEEEccCceeEEEec
Q psy3712           1 MEDGFRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFNAPVKGVRLR   80 (109)
Q Consensus         1 ~~~Gf~Iy~~~P~~~~~~~~~~~g~v~~veml~~tn~ialVg~g~~p~~~~n~v~IwDd~~~~~i~el~f~s~V~~V~l~   80 (109)
                      +++|++||+++|......++.  ++++.+++++++|++|++|++.      +.|+|||..+++.+.+++++++|.++.++
T Consensus        38 ~~~~~~iw~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~d------~~v~iWd~~~~~~~~~~~~~~~v~~v~~~  109 (355)
T 3vu4_A           38 TLKSFEIYNVHPVAHIMSQEM--RHLSKVRMLHRTNYVAFVTGVK------EVVHIWDDVKKQDVSRIKVDAPVKDLFLS  109 (355)
T ss_dssp             CSSEEEEEEETTEEEEEEEEC--SCCCEEEECTTSSEEEEECSST------TEEEEEETTTTEEEEEEECSSCEEEEEEC
T ss_pred             cCCEEEEEecCCcceeeeeec--CCeEEEEEcCCCCEEEEEECCc------cEEEEEECCCCcEEEEEECCCceEEEEEc
Confidence            367999999999988776653  4799999999999999999874      48999999999999999999999999999


Q ss_pred             CCEEEEEeCCeEEEEEcCCCCEEeEE
Q psy3712          81 RDKIVVVLEGLIKVYTFIQCPQQLHI  106 (109)
Q Consensus        81 r~~lvVvl~~~i~vy~~~~~~~ll~~  106 (109)
                      ++.++++.+++|++|++.+.++++++
T Consensus       110 ~~~~~~~~~~~i~i~d~~~~~~~~~~  135 (355)
T 3vu4_A          110 REFIVVSYGDVISVFKFGNPWKRITD  135 (355)
T ss_dssp             SSEEEEEETTEEEEEESSTTCCBSSC
T ss_pred             CCEEEEEEcCEEEEEECCCCceeeEE
Confidence            99999999999999999964365544
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.55
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.45
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 97.43
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.28
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.27
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.2
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.15
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.95
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.9
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.89
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 96.83
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.71
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.68
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.57
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.56
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.48
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 96.47
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.31
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.19
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.15
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 95.98
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.98
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.97
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 95.81
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.8
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.77
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 95.67
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.67
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.36
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.11
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 95.04
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 94.54
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.5
d1utca2 327 Clathrin heavy-chain terminal domain {Rat (Rattus 94.49
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 94.25
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 94.09
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.71
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.58
d1pgua2 287 Actin interacting protein 1 {Baker's yeast (Saccha 93.18
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 92.87
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.74
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 90.93
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 90.36
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 83.82
d1g291471 Maltose transport protein MalK, C-terminal domain 83.8
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 81.9
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

Probab=97.55  E-value=0.0021  Score=45.03  Aligned_cols=95  Identities=16%  Similarity=0.183  Sum_probs=70.4

Q ss_pred             eEEEeecCCceeeeeecCCCCEEEEEEcCCccEEEEEcCCCCCCCCCceEEEEeCCCCcEEEEEEcc--------CceeE
Q psy3712           5 FRIYNCDPLKEKERQDFTDGGLGHVEMLFRCNYLALVGGGTHPKYPNNRVMIWDDLKKQVVICLEFN--------APVKG   76 (109)
Q Consensus         5 f~Iy~~~P~~~~~~~~~~~g~v~~veml~~tn~ialVg~g~~p~~~~n~v~IwDd~~~~~i~el~f~--------s~V~~   76 (109)
                      .++|+..............+++..+.+-...+++|..+.       .+.+.+||...++.+.+++..        .+|.+
T Consensus       171 i~i~d~~~~~~~~~~~~~~~~i~~v~~~p~~~~l~~~~~-------d~~v~~~d~~~~~~~~~~~~~~~~~~~h~~~V~~  243 (311)
T d1nr0a1         171 VAIFEGPPFKFKSTFGEHTKFVHSVRYNPDGSLFASTGG-------DGTIVLYNGVDGTKTGVFEDDSLKNVAHSGSVFG  243 (311)
T ss_dssp             EEEEETTTBEEEEEECCCSSCEEEEEECTTSSEEEEEET-------TSCEEEEETTTCCEEEECBCTTSSSCSSSSCEEE
T ss_pred             cccccccccccccccccccccccccccCccccccccccc-------cccccccccccccccccccccccccccccccccc
Confidence            577777766554443334678888899888898876553       367999999999988877653        47999


Q ss_pred             EEecC--CEEEEEe-CCeEEEEEcCCCCEEeEEe
Q psy3712          77 VRLRR--DKIVVVL-EGLIKVYTFIQCPQQLHIY  107 (109)
Q Consensus        77 V~l~r--~~lvVvl-~~~i~vy~~~~~~~ll~~~  107 (109)
                      +.++.  ++|+..- +..|+||++. +.++++++
T Consensus       244 ~~~s~~~~~l~tgs~Dg~v~iwd~~-t~~~~~~l  276 (311)
T d1nr0a1         244 LTWSPDGTKIASASADKTIKIWNVA-TLKVEKTI  276 (311)
T ss_dssp             EEECTTSSEEEEEETTSEEEEEETT-TTEEEEEE
T ss_pred             cccCCCCCEEEEEeCCCeEEEEECC-CCcEEEEE
Confidence            99975  5666554 4679999998 57888775
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1g2914 b.40.6.3 (1:302-372) Maltose transport protein MalK, C-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure